SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g25060): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g25060): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g25060

Feature Type:gene_model
Chromosome:Gm04
Start:28660525
stop:28662942
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g25060
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G18710AT Annotation by Michelle Graham. TAIR10: SECY homolog 1 | chr2:8112231-8114452 REVERSE LENGTH=551 SoyBaseE_val: 2.00E-101ISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0009306GO-bp Annotation by Michelle Graham. GO Biological Process: protein secretion SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0015450GO-mf Annotation by Michelle Graham. GO Molecular Function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity SoyBaseN/AISS
PTHR10906Panther SECY/SEC61-ALPHA FAMILY MEMBER JGI ISS
PTHR10906:SF2Panther PROTEIN TRANSLOCASE SECY SUBUNIT JGI ISS
PF00344PFAM eubacterial secY protein JGI ISS
UniRef100_Q9XQU4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Preprotein translocase subunit SECY, chloroplastic n=1 Tax=Pisum sativum RepID=SECY_PEA SoyBaseE_val: 1.00E-104ISS
UniRef100_UPI000233A083UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A083 related cluster n=1 Tax=unknown RepID=UPI000233A083 SoyBaseE_val: 1.00E-125ISS

Expression Patterns of Glyma04g25060
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g25060 not represented in the dataset
Glyma04g25060 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g25060 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g157300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g25060
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g25060
>Glyma04g25060.1   sequence type=CDS   gene model=Glyma04g25060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAATACTGCGCACCTCTCTATCAGGTAAATAGTTCTGGAGTAATGCCTATCATATTTTCTACATCATCATTAGCTCTTCCTGGTACTTTAGCGCGCTTCACTGGTTTAACTGCACTAAAGAAGGCTTCAGTGGCGTTAAATCCAGGAGGTTCCTTCTACCTTCCATTTAACATACTTTTGATAGCCTTCTTCAACTACTATTACACTTTCCTACAACTGGATCCTGATGACGTGAGTGAACAATTGAAACGTCAAGGTGCTTCAATTCCACTTGTCAGACCAGGCAGAAGTGCAGCTACATTTATCAAAACAGTTCTTAGTAGAATATCAGTTCTGGGTTCAACATTTTTGGCTATCTTGGCTGCTGGTCCAACAGTTGTTGAACAGATCACTCACTTGACCGCATTCCGGGGATTTGTAGGAACATCTATTCTTATTCTTGTTGGTTGTGCAACAGACACAGCAAGAAAAGTTCAAGCTGAGATTATATCCCAAAAGTACAAGAACATAGAGTTCTATGATTTTGATAAGTATTGA
Predicted protein sequences of Glyma04g25060
>Glyma04g25060.1   sequence type=predicted peptide   gene model=Glyma04g25060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEYCAPLYQVNSSGVMPIIFSTSSLALPGTLARFTGLTALKKASVALNPGGSFYLPFNILLIAFFNYYYTFLQLDPDDVSEQLKRQGASIPLVRPGRSAATFIKTVLSRISVLGSTFLAILAAGPTVVEQITHLTAFRGFVGTSILILVGCATDTARKVQAEIISQKYKNIEFYDFDKY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo