Glyma04g24920 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g24920): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g24920): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g24920

Feature Type:	gene_model
Chromosome:	Gm04
Start:	28589162
stop:	28591788
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g24920

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G74030	AT	Annotation by Michelle Graham. TAIR10: enolase 1 \| chr1:27839465-27841901 REVERSE LENGTH=477	SoyBase	E_val: 7.00E-115	ISS
GO:0006096	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycolysis	SoyBase	N/A	ISS
GO:0010090	GO-bp	Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis	SoyBase	N/A	ISS
GO:0000015	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: phosphopyruvate hydratase complex	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0000287	GO-mf	Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding	SoyBase	N/A	ISS
GO:0004634	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphopyruvate hydratase activity	SoyBase	N/A	ISS
PTHR11902	Panther	ENOLASE	JGI		ISS
PF00113	PFAM	Enolase, C-terminal TIM barrel domain	JGI		ISS
UniRef100_I1KD55	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Enolase n=2 Tax=Glycine max RepID=I1KD55_SOYBN	SoyBase	E_val: 6.00E-126	ISS
UniRef100_UPI0002339530	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002339530 related cluster n=1 Tax=unknown RepID=UPI0002339530	SoyBase	E_val: 2.00E-134	ISS

Expression Patterns of Glyma04g24920

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g24920 not represented in the dataset	Glyma04g24920 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g24920 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g157000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g24920

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g24920

Limit To All Plant Sequences

>Glyma04g24920.2   sequence type=CDS   gene model=Glyma04g24920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATGTTGCAGCTTCAGAGTTTTACACTAAGGATGGGAAGTATGATTTGAACTTCATGAAACAGCCAAATGATGGAGCTCATGTTCACTCTACTCAGAGTCTTGGTCAACTATATAAAAATTATGTTAAAGAATTTCCCATTGTGTCAATTAAGGATCCGTTTGATCAAGATGATTGGGGTTCATGGGCTTCATTGCTTGCTTCAGTTGATATTCAACTTGTAGATGATTTGTTAGTTACAAATCCTAAGAGAATAGCTGAGGCCATCAAAAAGAAAGCTTGCAATGGTTTGCTTCTAAAGGTTAACCAGATTGGTACAGTGACCGAATCTATTCAGGCTGCACTTGACTCAAAGGCTGCAGGTTGGGGTGTAGTGGTTAGTCATCGGAGTGGCGAGACTGAGGATAACTTCATTGCTGATCTCTCTGTTGGCTTGGCCAGTGGACAGACAAAGACTGGTGCTCCTTGCCGAAGTGAGCGATTGGCAAAGTATAATCAGCTTCTTCGGATTGAAGAGGAACTTGGAAGTGTGCAATATGCTGGTGAAACTTTCAGATCACCTTAG

Predicted protein sequences of Glyma04g24920

Limit To All Plant Sequences

>Glyma04g24920.2   sequence type=predicted peptide   gene model=Glyma04g24920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDVAASEFYTKDGKYDLNFMKQPNDGAHVHSTQSLGQLYKNYVKEFPIVSIKDPFDQDDWGSWASLLASVDIQLVDDLLVTNPKRIAEAIKKKACNGLLLKVNQIGTVTESIQAALDSKAAGWGVVVSHRSGETEDNFIADLSVGLASGQTKTGAPCRSERLAKYNQLLRIEEELGSVQYAGETFRSP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain