SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g24640

Feature Type:gene_model
Chromosome:Gm04
Start:28293933
stop:28294806
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g24640
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G33720AT Annotation by Michelle Graham. TAIR10: AP2/B3-like transcriptional factor family protein | chr2:14263776-14264989 FORWARD LENGTH=326 SoyBaseE_val: 1.00E-26ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
UniRef100_I1JWD8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JWD8_SOYBN SoyBaseE_val: 1.00E-125ISS
UniRef100_I2FKG6UniRef Annotation by Michelle Graham. Most informative UniRef hit: E1 protein n=1 Tax=Glycine max RepID=I2FKG6_SOYBN SoyBaseE_val: 2.00E-107ISS

Proteins Associated with Glyma04g24640
LocusGene SymbolProtein Name
E1 E1-1 E1 gene 1

Expression Patterns of Glyma04g24640
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g24640 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g156400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g24640
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g24640
>Glyma04g24640.1   sequence type=CDS   gene model=Glyma04g24640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTTTACAATCACAAATCCCATCAAAGTTTAAAATAATATTCATCTCTTCCAACATGAGCAATCCTTCAGATGAGAAGGAGCAGTGTCAAAAGAAGAGGAAATCCACCATATGTGAAGCCTCCAACTTTAAGACATCAAGGAGAAGATTCTTCAGCAACAAAAATGAAGAGGATATGAACAAGGGAGTTTCAACAACACTGAAGCTTTACGATGACCCTTGGAAGATCAAGAAGACGCTAACCGATAGCGATTTGGGAATCCTAAGTAGACTCTCGCTGGCTGCAGATTTGGTGAAGAAGCAAATTTTGCCTATGTTGGGTGCAGATCATGCAAGAGCTGCAGAAACTGAAGAAGGGACCCCAGTTAGAGTTTGGGACATGGACACCAAATCCATGCACCAGCTCGTTCTAAAGCGATGGTCTTCATCCAAGAGCTATGTTCTTATTGGAAAGTGGAACCAAGATTTCGTGAGAAGAAGAGATCTCAAGAAAGGGGATGAGATCGGATTTCATTGGGATCCGTATAATTGCGTTTTCAATTTCTGTGTCCTTAAACGAGCTATGCCAGAGAATTAA
Predicted protein sequences of Glyma04g24640
>Glyma04g24640.1   sequence type=predicted peptide   gene model=Glyma04g24640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSLQSQIPSKFKIIFISSNMSNPSDEKEQCQKKRKSTICEASNFKTSRRRFFSNKNEEDMNKGVSTTLKLYDDPWKIKKTLTDSDLGILSRLSLAADLVKKQILPMLGADHARAAETEEGTPVRVWDMDTKSMHQLVLKRWSSSKSYVLIGKWNQDFVRRRDLKKGDEIGFHWDPYNCVFNFCVLKRAMPEN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo