SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g24003

Feature Type:gene_model
Chromosome:Gm04
Start:27463396
stop:27464878
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g24003
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G28380AT Annotation by Michelle Graham. TAIR10: dsRNA-binding protein 2 | chr2:12134098-12135915 REVERSE LENGTH=434 SoyBaseE_val: 4.00E-13ISS
GO:0010267GO-bp Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference SoyBaseN/AISS
GO:0035196GO-bp Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA SoyBaseN/AISS
GO:0051607GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to virus SoyBaseN/AISS
GO:0070919GO-bp Annotation by Michelle Graham. GO Biological Process: production of siRNA involved in chromatin silencing by small RNA SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0003725GO-mf Annotation by Michelle Graham. GO Molecular Function: double-stranded RNA binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF00035PFAM Double-stranded RNA binding motif JGI ISS
UniRef100_B9T2K0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Double-stranded RNA binding protein, putative n=1 Tax=Ricinus communis RepID=B9T2K0_RICCO SoyBaseE_val: 2.00E-34ISS
UniRef100_I1M869UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1M869_SOYBN SoyBaseE_val: 8.00E-83ISS

Expression Patterns of Glyma04g24003
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g24003 not represented in the dataset
Glyma04g24003 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g24003 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g154800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g24003
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g24003
>Glyma04g24003.1   sequence type=CDS   gene model=Glyma04g24003   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCACAAAACTCGTCTCCAAGACTTTACTTCAAAGTCAGGCATTCAATTTCCTGTCTATCATACCATTAATGAGGGACAGGATCATATTCCAAAGTTTAGATCGACGGTGTGGGATGTAGCTAGACTTGCTTTGGAGGGTATCCTCCATAGGACCAGAGATGAAGGACTCTTTCTTGTTGATCAGATTTCTCCAATTTTCAAGTCTATCATGAATGAGTATGCTCATAAACTGCATGTAGAACAACCTACATACAACAATGATAAGCAACTGCTAGGAGGGGTGCTTCCTGCTTTTATAACTTCTTTGGTTTTCAATGGTACAAGTTACACTGGTGGTCCAGCTGGAACAAAAAAGGATGTTGAGCAGTCAGCCGCAAAGGCTGCAATTCTTTCAATTATGGGTGATTCTAGCTCGGGAACTTCACTTGCCGAGATTATTAGGTCAAAGTCTATATTTTACGATGCA
Predicted protein sequences of Glyma04g24003
>Glyma04g24003.1   sequence type=predicted peptide   gene model=Glyma04g24003   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHKTRLQDFTSKSGIQFPVYHTINEGQDHIPKFRSTVWDVARLALEGILHRTRDEGLFLVDQISPIFKSIMNEYAHKLHVEQPTYNNDKQLLGGVLPAFITSLVFNGTSYTGGPAGTKKDVEQSAAKAAILSIMGDSSSGTSLAEIIRSKSIFYDA






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo