Glyma04g23990 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g23990

Feature Type:	gene_model
Chromosome:	Gm04
Start:	27455149
stop:	27458435
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g23990

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G53650	AT	Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 15 growth stages; Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). \| chr5:21791265-21792242 FORWARD LENGTH=72	SoyBase	E_val: 3.00E-23	ISS
GO:0006626	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion	SoyBase	N/A	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009062	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid catabolic process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_I1JWB9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JWB9_SOYBN	SoyBase	E_val: 3.00E-41	ISS

Expression Patterns of Glyma04g23990

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g23990 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g154600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g23990

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g23990

Limit To All Plant Sequences

>Glyma04g23990.1   sequence type=CDS   gene model=Glyma04g23990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGAGTGAGATTGGCGTCGTTCTTCACTGGGGCTGCCGCGGCGTCGTTTCTGGGGCTCTACACCCTCCACAAGGATTACAAGGTCGCGCACCAATCCTTTACTCAACAGATGAATGACCTCCACAAATCGCTGGAAGGTCGAATTTCTTCCTTGGAAAAACTGAAACAAACGGAAACGTCTGAACAGGTTGAAGCAACTGAATAA

Predicted protein sequences of Glyma04g23990

Limit To All Plant Sequences

>Glyma04g23990.1   sequence type=predicted peptide   gene model=Glyma04g23990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRVRLASFFTGAAAASFLGLYTLHKDYKVAHQSFTQQMNDLHKSLEGRISSLEKLKQTETSEQVEATE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain