|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G53650 | AT | Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 15 growth stages; Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr5:21791265-21792242 FORWARD LENGTH=72 | SoyBase | E_val: 3.00E-23 | ISS |
| GO:0006626 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion | SoyBase | N/A | ISS |
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
| GO:0009062 | GO-bp | Annotation by Michelle Graham. GO Biological Process: fatty acid catabolic process | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| UniRef100_I1JWB9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JWB9_SOYBN | SoyBase | E_val: 3.00E-41 | ISS |
|
Glyma04g23990 not represented in the dataset |
Glyma04g23990 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.04g154600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma04g23990.1 sequence type=CDS gene model=Glyma04g23990 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAGAGTGAGATTGGCGTCGTTCTTCACTGGGGCTGCCGCGGCGTCGTTTCTGGGGCTCTACACCCTCCACAAGGATTACAAGGTCGCGCACCAATCCTTTACTCAACAGATGAATGACCTCCACAAATCGCTGGAAGGTCGAATTTCTTCCTTGGAAAAACTGAAACAAACGGAAACGTCTGAACAGGTTGAAGCAACTGAATAA
>Glyma04g23990.1 sequence type=predicted peptide gene model=Glyma04g23990 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MRVRLASFFTGAAAASFLGLYTLHKDYKVAHQSFTQQMNDLHKSLEGRISSLEKLKQTETSEQVEATE*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||