Report for Sequence Feature Glyma04g23990
Feature Type: gene_model
Chromosome: Gm04
Start: 27455149
stop: 27458435
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g23990
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G53650 AT
Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 15 growth stages; Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr5:21791265-21792242 FORWARD LENGTH=72
SoyBase E_val: 3.00E-23 ISS
GO:0006626 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion
SoyBase N/A ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0009062 GO-bp
Annotation by Michelle Graham. GO Biological Process: fatty acid catabolic process
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I1JWB9 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JWB9_SOYBN
SoyBase E_val: 3.00E-41 ISS
Expression Patterns of Glyma04g23990
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma04g23990 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g154600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g23990
Coding sequences of Glyma04g23990
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g23990.1 sequence type=CDS gene model=Glyma04g23990 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAGAGTGAGATTGGCGTCGTTCTTCACTGGGGCTGCCGCGGCGTCGTTTCTGGGGCTCTACACCCTCCACAAGGATTACAAGGTCGCGCACCAATCCTTTACTCAACAGATGAATGACCTCCACAAATCGCTGGAAGGTCGAATTTCTTCCTTGGAAAAACTGAAACAAACGGAAACGTCTGAACAGGTTGAAGCAACTGAATAA
Predicted protein sequences of Glyma04g23990
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g23990.1 sequence type=predicted peptide gene model=Glyma04g23990 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MRVRLASFFTGAAAASFLGLYTLHKDYKVAHQSFTQQMNDLHKSLEGRISSLEKLKQTETSEQVEATE*