Glyma04g23550 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g23550): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g23550): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g23550

Feature Type:	gene_model
Chromosome:	Gm04
Start:	26761908
stop:	26772375
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g23550

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G24060	AT	Annotation by Michelle Graham. TAIR10: Translation initiation factor 3 protein \| chr2:10229453-10231390 FORWARD LENGTH=312	SoyBase	E_val: 3.00E-85	ISS
GO:0006413	GO-bp	Annotation by Michelle Graham. GO Biological Process: translational initiation	SoyBase	N/A	ISS
GO:0009073	GO-bp	Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family biosynthetic process	SoyBase	N/A	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0016226	GO-bp	Annotation by Michelle Graham. GO Biological Process: iron-sulfur cluster assembly	SoyBase	N/A	ISS
GO:0019288	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	SoyBase	N/A	ISS
GO:0045036	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to chloroplast	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003743	GO-mf	Annotation by Michelle Graham. GO Molecular Function: translation initiation factor activity	SoyBase	N/A	ISS
PTHR10938	Panther	TRANSLATION INITIATION FACTOR IF-3	JGI		ISS
PF00707	PFAM	Translation initiation factor IF-3, C-terminal domain	JGI		ISS
PF05198	PFAM	Translation initiation factor IF-3, N-terminal domain	JGI		ISS
UniRef100_C6SX90	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Translation initiation factor IF-3 n=1 Tax=Glycine max RepID=C6SX90_SOYBN	SoyBase	E_val: 6.00E-176	ISS
UniRef100_C6SX90	UniRef	Annotation by Michelle Graham. Best UniRef hit: Translation initiation factor IF-3 n=1 Tax=Glycine max RepID=C6SX90_SOYBN	SoyBase	E_val: 6.00E-176	ISS

Expression Patterns of Glyma04g23550

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g23550 not represented in the dataset	Glyma04g23550 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g23550 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g154000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g23550

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g23550

Limit To All Plant Sequences

>Glyma04g23550.1   sequence type=CDS   gene model=Glyma04g23550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGCGCAGTGGGTGGGTTTACTCTCACTCTCAGTCCCATCAATTTGAAACTCCCCCTTCTCCCTTCCAATCGCCTCTTTAACCGCACTCCCTTCAAATCTTCCATTTCCTTCTCCCTACGCTCCAACGACGAGCAACAACCCCTCGGCCTCGACATCGCCGCACTAAGGTCAGCTTCCGTGAGGCTCATTGATGGGAATCAGATCATGGTCGGAGTTGTGTCCAAGACTCTGGCCCGTCAAATGGCCCAGGATTCTGAACTCGACCTGGTGATAGTATCCCCAGATGCAGATCCTCCTGTTGTTAGAATGATGGATTACAATAAGTATAAATATGAACAGCAAAAGAAGAAAAAAGGACAGCAGAAAAGAAGTGCTGCTAATCGGATGGATTTGAAGGAGCTCAAAATGGGATACAACATAGACCAACATGATTATTCTGTGCGTTTGAAAGCTGCCCAGAAATTTTTGAAAGATGGTGACAAGGTTAAAGTCATAGTGAACCTCAAAGGCCGTGAAACTGAATTCAGGAATATTGCTATTGAGCTTATTAAACGTTTCCAGAGTGATGTTGGGGAGCTTGCAACAGAAGAGACTAAAAGCTTTCGTGACAGAAACATGTCCATAGTTATGGTTCCAAAGAAAGCCGCTCTACAGAAAGCTCAAGAACCACCGAAGAGAAAAGACATGTCAGCAGCAGATGAAGTCTCCGCTGGTGTCCAACATAACTGA

Predicted protein sequences of Glyma04g23550

Limit To All Plant Sequences

>Glyma04g23550.1   sequence type=predicted peptide   gene model=Glyma04g23550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSAVGGFTLTLSPINLKLPLLPSNRLFNRTPFKSSISFSLRSNDEQQPLGLDIAALRSASVRLIDGNQIMVGVVSKTLARQMAQDSELDLVIVSPDADPPVVRMMDYNKYKYEQQKKKKGQQKRSAANRMDLKELKMGYNIDQHDYSVRLKAAQKFLKDGDKVKVIVNLKGRETEFRNIAIELIKRFQSDVGELATEETKSFRDRNMSIVMVPKKAALQKAQEPPKRKDMSAADEVSAGVQHN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain