SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g23110): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g23110): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g23110

Feature Type:gene_model
Chromosome:Gm04
Start:26397138
stop:26398040
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g23110
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G01150AT Annotation by Michelle Graham. TAIR10: RING-H2 finger protein 2B | chr2:100703-101146 FORWARD LENGTH=147 SoyBaseE_val: 3.00E-14ISS
GO:0080167GO-bp Annotation by Michelle Graham. GO Biological Process: response to karrikin SoyBaseN/AISS
GO:0004842GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR22764Panther RING FINGER PROTEIN 11 (SID 1669) (NEDD4 WW DOMAIN-BINDING PROTEIN 2). JGI ISS
PTHR22764:SF25Panther OS04G0579200 PROTEIN JGI ISS
PF00097PFAM Zinc finger, C3HC4 type (RING finger) JGI ISS
UniRef100_G7JYH1UniRef Annotation by Michelle Graham. Most informative UniRef hit: E3 ubiquitin-protein ligase n=1 Tax=Medicago truncatula RepID=G7JYH1_MEDTR SoyBaseE_val: 4.00E-47ISS
UniRef100_I1JWB1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JWB1_SOYBN SoyBaseE_val: 2.00E-97ISS

Expression Patterns of Glyma04g23110
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g23110 not represented in the dataset
Glyma04g23110 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g23110 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g153400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g23110
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g23110
>Glyma04g23110.1   sequence type=CDS   gene model=Glyma04g23110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTGAGTAAGTACCTAGCTCCAATTTATACTCATCTCAAATGGGTATTAGATTTTGTTCTCTACTACCCTTTTTACATGCTTTATGATTCTCATCCACCCATAAATCTTGGAACTGAATTGAGTACATTTCATTATGAATTTTCCTCTGGCTCAGAGGAACATGTGGATTGTGCTGTGTGTCTAAGCAAATTTGGAGAAGGAGATGAGGTGATTAGAGTTATGAGATGTGAGCATGTCTTCCACAAAGGTTGTTTGGATAGATGGGTTGGTTTCGAGAATGCCACGTGTCCTCTTTGCAGAGGATCACTGACTCCAAAAAGGCCTATCACTAACTCTGGAGCTGAGGTTGTGCTATTTCAGTTTTGTTCTGTCCAAAAGTGTAATGATGAGACATGGTGGCTACGCTGA
Predicted protein sequences of Glyma04g23110
>Glyma04g23110.1   sequence type=predicted peptide   gene model=Glyma04g23110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLSKYLAPIYTHLKWVLDFVLYYPFYMLYDSHPPINLGTELSTFHYEFSSGSEEHVDCAVCLSKFGEGDEVIRVMRCEHVFHKGCLDRWVGFENATCPLCRGSLTPKRPITNSGAEVVLFQFCSVQKCNDETWWLR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo