Report for Sequence Feature Glyma04g23050
Feature Type: gene_model
Chromosome: Gm04
Start: 26290134
stop: 26291593
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g23050
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G26170 AT
Annotation by Michelle Graham. TAIR10: ARM repeat superfamily protein | chr1:9047539-9054438 REVERSE LENGTH=1022
SoyBase E_val: 4.00E-66 ISS
GO:0000059 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein import into nucleus, docking
SoyBase N/A ISS
GO:0000226 GO-bp
Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization
SoyBase N/A ISS
GO:0000911 GO-bp
Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation
SoyBase N/A ISS
GO:0006886 GO-bp
Annotation by Michelle Graham. GO Biological Process: intracellular protein transport
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005643 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nuclear pore
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0008565 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein transporter activity
SoyBase N/A ISS
PTHR10997 Panther
IMPORTIN (RAN-BINDING PROTEIN)
JGI ISS
PTHR10997:SF9 Panther
IMPORTIN-ALPHA RE-EXPORTER RELATED
JGI ISS
UniRef100_F4IE40 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Armadillo/beta-catenin-like repeat-containing protein n=1 Tax=Arabidopsis thaliana RepID=F4IE40_ARATH
SoyBase E_val: 2.00E-63 ISS
UniRef100_I1JWA9 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JWA9_SOYBN
SoyBase E_val: 9.00E-114 ISS
Expression Patterns of Glyma04g23050
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma04g23050 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma04g23050
Coding sequences of Glyma04g23050
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g23050.1 sequence type=CDS gene model=Glyma04g23050 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATCATCCGCATAATGCTTCTATTGGCATTGAATGACCCTCATAAGAAAATTTGCACGACTATTGGTATGGTTGTGGCATCCATTGCAATGCATGACTGGCTAGAGTTATGGCCGGATTTGTTACCATTTCTCCTGAATTTGATTAACAATCAAACCAACATGAATGGAGTGCATGGAGCTATGAGATGCTTGGTTCTTCTCTCTATGGACTTGGATGATAAAATGGTTCCAAAATTAATACCTACTATGTTCTCGAGTTTTCTGAAAATTGTCTCCTCTCCCCAGATATATGATCCATACATTCGAATAAAGGCCCTTTCAATAATCTATTCTTGCACTTCTATACTGGGGACAATGAGTGGTGTCTATAAGGAAGAAACTAGTTCTCTGATAGTTCCTTTGCTTAAACCATGGATGGGCCAATTTTCTTTTATTCTACAAATTCCAGTTCAATCTGAAAATCCAGATGATTGGAGTATTAAAATGGAG
Predicted protein sequences of Glyma04g23050
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g23050.1 sequence type=predicted peptide gene model=Glyma04g23050 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
IIRIMLLLALNDPHKKICTTIGMVVASIAMHDWLELWPDLLPFLLNLINNQTNMNGVHGAMRCLVLLSMDLDDKMVPKLIPTMFSSFLKIVSSPQIYDPYIRIKALSIIYSCTSILGTMSGVYKEETSSLIVPLLKPWMGQFSFILQIPVQSENPDDWSIKME