SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g23050): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g23050): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g23050

Feature Type:gene_model
Chromosome:Gm04
Start:26290134
stop:26291593
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g23050
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G26170AT Annotation by Michelle Graham. TAIR10: ARM repeat superfamily protein | chr1:9047539-9054438 REVERSE LENGTH=1022 SoyBaseE_val: 4.00E-66ISS
GO:0000059GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into nucleus, docking SoyBaseN/AISS
GO:0000226GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization SoyBaseN/AISS
GO:0000911GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation SoyBaseN/AISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005643GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nuclear pore SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0008565GO-mf Annotation by Michelle Graham. GO Molecular Function: protein transporter activity SoyBaseN/AISS
PTHR10997Panther IMPORTIN (RAN-BINDING PROTEIN) JGI ISS
PTHR10997:SF9Panther IMPORTIN-ALPHA RE-EXPORTER RELATED JGI ISS
UniRef100_F4IE40UniRef Annotation by Michelle Graham. Most informative UniRef hit: Armadillo/beta-catenin-like repeat-containing protein n=1 Tax=Arabidopsis thaliana RepID=F4IE40_ARATH SoyBaseE_val: 2.00E-63ISS
UniRef100_I1JWA9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JWA9_SOYBN SoyBaseE_val: 9.00E-114ISS

Expression Patterns of Glyma04g23050
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g23050 not represented in the dataset
Glyma04g23050 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g23050 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma04g23050
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g23050
>Glyma04g23050.1   sequence type=CDS   gene model=Glyma04g23050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATCATCCGCATAATGCTTCTATTGGCATTGAATGACCCTCATAAGAAAATTTGCACGACTATTGGTATGGTTGTGGCATCCATTGCAATGCATGACTGGCTAGAGTTATGGCCGGATTTGTTACCATTTCTCCTGAATTTGATTAACAATCAAACCAACATGAATGGAGTGCATGGAGCTATGAGATGCTTGGTTCTTCTCTCTATGGACTTGGATGATAAAATGGTTCCAAAATTAATACCTACTATGTTCTCGAGTTTTCTGAAAATTGTCTCCTCTCCCCAGATATATGATCCATACATTCGAATAAAGGCCCTTTCAATAATCTATTCTTGCACTTCTATACTGGGGACAATGAGTGGTGTCTATAAGGAAGAAACTAGTTCTCTGATAGTTCCTTTGCTTAAACCATGGATGGGCCAATTTTCTTTTATTCTACAAATTCCAGTTCAATCTGAAAATCCAGATGATTGGAGTATTAAAATGGAG
Predicted protein sequences of Glyma04g23050
>Glyma04g23050.1   sequence type=predicted peptide   gene model=Glyma04g23050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
IIRIMLLLALNDPHKKICTTIGMVVASIAMHDWLELWPDLLPFLLNLINNQTNMNGVHGAMRCLVLLSMDLDDKMVPKLIPTMFSSFLKIVSSPQIYDPYIRIKALSIIYSCTSILGTMSGVYKEETSSLIVPLLKPWMGQFSFILQIPVQSENPDDWSIKME






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo