Glyma04g22334 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g22334): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g22334): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g22334

Feature Type:	gene_model
Chromosome:	Gm04
Start:	25522769
stop:	25523997
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g22334

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G47790	AT	Annotation by Michelle Graham. TAIR10: ABC2 homolog 7 \| chr3:17629584-17633711 FORWARD LENGTH=901	SoyBase	E_val: 6.00E-29	ISS
GO:0006499	GO-bp	Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0005215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transporter activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016887	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATPase activity	SoyBase	N/A	ISS
GO:0017111	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity	SoyBase	N/A	ISS
GO:0042626	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATPase activity, coupled to transmembrane movement of substances	SoyBase	N/A	ISS
PTHR19229	Panther	ATP-BINDING CASSETTE TRANSPORTER SUBFAMILY A (ABCA)	JGI		ISS
PTHR19229:SF69	Panther	ATATH7 (ABC2 HOMOLOG 7), ATPASE, COUPLED TO TRANSM	JGI		ISS
UniRef100_G7JQX2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ABC transporter A family member n=1 Tax=Medicago truncatula RepID=G7JQX2_MEDTR	SoyBase	E_val: 7.00E-35	ISS
UniRef100_I1JWX7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JWX7_SOYBN	SoyBase	E_val: 2.00E-36	ISS

Expression Patterns of Glyma04g22334

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g22334 not represented in the dataset	Glyma04g22334 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g22334 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g152300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g22334

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g22334

Limit To All Plant Sequences

>Glyma04g22334.1   sequence type=CDS   gene model=Glyma04g22334   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCGTGTTTTGTGATATTTGGCTCAGTCATAGGATTGAATTTCTTCACAATGAATGACTACAACATCCAATTCGTGTTTTATTTCATCTATATAAATTTACAAATTTCACTGGCTTTTTTATTGGCTTCCCTGTTTTCAAATGTTAAACTTGCTACAGTACTTGCATACATTGGTGTGTTTGGAGCTGGGCTATTAGCTGGCTTTCTTTTCCAATTTTTTGTTCAAGACACGTCATTTCCAAATGACGATGACTAA

Predicted protein sequences of Glyma04g22334

Limit To All Plant Sequences

>Glyma04g22334.1   sequence type=predicted peptide   gene model=Glyma04g22334   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPCFVIFGSVIGLNFFTMNDYNIQFVFYFIYINLQISLAFLLASLFSNVKLATVLAYIGVFGAGLLAGFLFQFFVQDTSFPNDDD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain