|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G45650 | AT | Annotation by Michelle Graham. TAIR10: AGAMOUS-like 6 | chr2:18804453-18806291 FORWARD LENGTH=252 | SoyBase | E_val: 3.00E-19 | ISS |
| GO:0006355 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0009911 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of flower development | SoyBase | N/A | ISS |
| GO:0010228 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem | SoyBase | N/A | ISS |
| GO:0048437 | GO-bp | Annotation by Michelle Graham. GO Biological Process: floral organ development | SoyBase | N/A | ISS |
| GO:0048481 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ovule development | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS |
| GO:0003700 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| PTHR11945 | Panther | MADS BOX PROTEIN | JGI | ISS | |
| PTHR11945:SF19 | Panther | MADS BOX PROTEIN | JGI | ISS | |
| PF01486 | PFAM | K-box region | JGI | ISS | |
| UniRef100_Q8LLR1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: MADS-box protein 3 n=1 Tax=Vitis vinifera RepID=Q8LLR1_VITVI | SoyBase | E_val: 1.00E-38 | ISS |
| UniRef100_UPI00023393B2 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI00023393B2 related cluster n=1 Tax=unknown RepID=UPI00023393B2 | SoyBase | E_val: 2.00E-50 | ISS |
|
Glyma04g22164 not represented in the dataset |
Glyma04g22164 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma04g22164.1 sequence type=CDS gene model=Glyma04g22164 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ACTACCAAAACTATTGAGCGATACTATCGTAGCTCTTTTACTCCTCAAGACGAACACGTTGAATGTGAAACTCAGAGCTGGTACCAAGAGGTGTCAAAGCTAAAGGCAAAGTATGATTCTCTTCAAAGGACCCAGAGGCATTTTCTTGGGGAAGATCTTGGACCATTGAACACAAAGGAGCTGCAGAATCTTGAGAAACAACTTGAAGGGTCTTTAGCACAACCAAGGCAAAGGAAGGTGCGAACACATATATGTAGAATTTCTCTTTATTGCTCTATGGATTCTTGA
>Glyma04g22164.1 sequence type=predicted peptide gene model=Glyma04g22164 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high TTKTIERYYRSSFTPQDEHVECETQSWYQEVSKLKAKYDSLQRTQRHFLGEDLGPLNTKELQNLEKQLEGSLAQPRQRKVRTHICRISLYCSMDS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||