Glyma04g22140 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g22140): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g22140): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g22140

Feature Type:	gene_model
Chromosome:	Gm04
Start:	25360541
stop:	25361310
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g22140

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G77920	AT	Annotation by Michelle Graham. TAIR10: bZIP transcription factor family protein \| chr1:29298959-29300607 FORWARD LENGTH=368	SoyBase	E_val: 6.00E-37	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009410	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to xenobiotic stimulus	SoyBase	N/A	ISS
GO:0030968	GO-bp	Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response	SoyBase	N/A	ISS
GO:0042742	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0005516	GO-mf	Annotation by Michelle Graham. GO Molecular Function: calmodulin binding	SoyBase	N/A	ISS
PTHR22952	Panther	CAMP-RESPONSE ELEMENT BINDING PROTEIN-RELATED	JGI		ISS
PTHR22952:SF53	Panther	SUBFAMILY NOT NAMED	JGI		ISS
UniRef100_A4ZGS2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor bZIP83 (Fragment) n=1 Tax=Glycine max RepID=A4ZGS2_SOYBN	SoyBase	E_val: 2.00E-45	ISS
UniRef100_I1JZC2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JZC2_SOYBN	SoyBase	E_val: 1.00E-53	ISS

Expression Patterns of Glyma04g22140

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g22140 not represented in the dataset	Glyma04g22140 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g22140 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g151800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g22140

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g22140

Limit To All Plant Sequences

>Glyma04g22140.1   sequence type=CDS   gene model=Glyma04g22140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAAGCACCTGATGTACAACTCAACGTAGTAGTTCAGAGTGTCTTAAACCATTACTCAAATCTTTTCATAATGAAAGCAGATGTTGTAAAGGCTGATGTCCTCTATTTACTCTCTGGTGCGTGGAAACCATCAGTGGAGCGAATTTTCCTTTGGATTGGAGGCTCTCGTCCATCGCAGCTTCTAAACATCATCGTGCCTCAACTTGAGCCTTTGATTGATCAACAAATTGTTAGTATTAACAACCTCCGCCTATCGTCTCAACAAGCTGAAGATGCTCTTTGA

Predicted protein sequences of Glyma04g22140

Limit To All Plant Sequences

>Glyma04g22140.1   sequence type=predicted peptide   gene model=Glyma04g22140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQAPDVQLNVVVQSVLNHYSNLFIMKADVVKADVLYLLSGAWKPSVERIFLWIGGSRPSQLLNIIVPQLEPLIDQQIVSINNLRLSSQQAEDAL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain