Report for Sequence Feature Glyma04g21900
Feature Type: gene_model
Chromosome: Gm04
Start: 25204436
stop: 25209572
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g21900
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G22950 AT
Annotation by Michelle Graham. TAIR10: SNF7 family protein | chr5:7681380-7682720 FORWARD LENGTH=229
SoyBase E_val: 6.00E-129 ISS
GO:0006623 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole
SoyBase N/A ISS
GO:0015031 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein transport
SoyBase N/A ISS
GO:0016192 GO-bp
Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport
SoyBase N/A ISS
GO:0000815 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: ESCRT III complex
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
KOG3229
KOG
Vacuolar sorting protein VPS24
JGI ISS
PTHR10476 Panther
SNF7-RELATED
JGI ISS
PTHR10476:SF1 Panther
CHMP1 - RELATED
JGI ISS
PF03357 PFAM
Snf7
JGI ISS
UniRef100_C6TGZ1 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TGZ1_SOYBN
SoyBase E_val: 3.00E-159 ISS
UniRef100_D7M1L2 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: SNF7 family protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7M1L2_ARALL
SoyBase E_val: 9.00E-128 ISS
Expression Patterns of Glyma04g21900
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma04g21900
Paralog Evidence Comments
Glyma06g23570 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g21900 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g151500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g21900
Coding sequences of Glyma04g21900
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g21900.1 sequence type=CDS gene model=Glyma04g21900 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAGAAGGTGATGAACATTCTGAAGCCAAAGCCAAATCCGCAGCAACTATTGAGGGATTGGCAGCGTAGGCTTCGCCAAGAGTGTCGCAACATTGAGCGCCAAATTCGCGATATACAGAGAGAAGAAAAAAATGTGCAGAAGGCAATTAGAGAAGCTGCAAAGAGGAATGACATGGGCTCTGCAAAGGCACTTGCTAAGGAACTTGTGAGATCTAGGAAAACTGTGAACCGTCTTTATGAAAATAAAGCACAAATGAATTCAATATCAATGCACCTTGGAGAGAGTGTTGCAATTGCTCGTACTGTGGGACATCTATCAAAGAGTGCTGAGGTTATGAAACTTGTCAATAATCTCATGAAGGCTCCCGAAATGGCGGTGACAATGCAAGAGTTCAGCAAAGAAATGACAAAGGCAGGAGTTATCGAAGAGATAGTAAATGATGCCATTGACACAGCGCTAGATTCTGAGGACATAGAAGATGAGATAGAAGAAGAAGTTGACAAAGTCTTGACTGCAATAGCTGGTGAGACAGCTGCACAACTTCCTGAAGCTGTGAGAAAAGAGAGGGTGAAGCTACCTGGTCAAAGTGTTGGAGCAGAGGAAGAGGTTATAGCTGAGGGTGTTGACGATGAAGAAGAAATGGAGGAAATAAGGGCTCGGCTTGCTAAAGTTCGGTCATAA
Predicted protein sequences of Glyma04g21900
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g21900.1 sequence type=predicted peptide gene model=Glyma04g21900 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MEKVMNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIREAAKRNDMGSAKALAKELVRSRKTVNRLYENKAQMNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMKAPEMAVTMQEFSKEMTKAGVIEEIVNDAIDTALDSEDIEDEIEEEVDKVLTAIAGETAAQLPEAVRKERVKLPGQSVGAEEEVIAEGVDDEEEMEEIRARLAKVRS*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
