SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g21753

Feature Type:gene_model
Chromosome:Gm04
Start:25102759
stop:25104513
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g21753
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G26730AT Annotation by Michelle Graham. TAIR10: Leucine-rich repeat protein kinase family protein | chr2:11388621-11391286 FORWARD LENGTH=658 SoyBaseE_val: 8.00E-116ISS
GO:0000272GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide catabolic process SoyBaseN/AISS
GO:0005982GO-bp Annotation by Michelle Graham. GO Biological Process: starch metabolic process SoyBaseN/AISS
GO:0006084GO-bp Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process SoyBaseN/AISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0007020GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule nucleation SoyBaseN/AISS
GO:0007169GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane receptor protein tyrosine kinase signaling pathway SoyBaseN/AISS
GO:0007389GO-bp Annotation by Michelle Graham. GO Biological Process: pattern specification process SoyBaseN/AISS
GO:0008361GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell size SoyBaseN/AISS
GO:0009664GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization SoyBaseN/AISS
GO:0009832GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis SoyBaseN/AISS
GO:0009926GO-bp Annotation by Michelle Graham. GO Biological Process: auxin polar transport SoyBaseN/AISS
GO:0010015GO-bp Annotation by Michelle Graham. GO Biological Process: root morphogenesis SoyBaseN/AISS
GO:0010075GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth SoyBaseN/AISS
GO:0016126GO-bp Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process SoyBaseN/AISS
GO:0016132GO-bp Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process SoyBaseN/AISS
GO:0040007GO-bp Annotation by Michelle Graham. GO Biological Process: growth SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0004713GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PTHR24420:SF779Panther JGI ISS
PF00069PFAM Protein kinase domain JGI ISS
UniRef100_D6N3G3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein kinase n=1 Tax=Malus x domestica RepID=D6N3G3_MALDO SoyBaseE_val: 6.00E-113ISS
UniRef100_I1JW92UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JW92_SOYBN SoyBaseE_val: 5.00E-149ISS

Expression Patterns of Glyma04g21753
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g21753 not represented in the dataset
Glyma04g21753 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g21753 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g151200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g21753
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g21753
>Glyma04g21753.1   sequence type=CDS   gene model=Glyma04g21753   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAATAGCACTGGGAGCTGCAAGAGGCCTCGCGTGCCTCCACGTGTCATGCAAACTGGTCCACGGTAACATCAAATCCTCCAACATCCTCTTCCACCCGACCCACGAAGCCTGTGTTTCAGACTTCGGGCTCAACCCGATATTCGCAAACCCGGTCCCCTTGAACCGAGTCGCGGGTTATCGGGCACCAGAGGTTCAGGAAACCAGAAAGGTCACCTTCAAATCGGATGTGTACAGTTTCGGCGTGCTGATGCTGGAACTTCTAACAGGTAAGGCACCAAACCAAGCCTCGCTGAGCGAGGAAGGGATCGACCTTCCGCGATGGGTGCAGTCTGTGGTTCGTGAAGAGTGGACCGCTGAAGTGTTCGACGCGGAACTCATGAGGTACCATAACATTGAAGAGGAGATGGTTCGGTTGTTGCAGATTGCGATGACGTGCGTTTCGCTCGTGCCAGATCAGAGGCCCAACATGGATGAGGTGGTGCGCATGATCGAAGATATTAGCCGCAGCGAGACCACCGATGATGGGTTACGCCAGTCGTCTGATGATCCTTCGAAAGGATCGGACGGTCACACGCCCCCGCAGGACGCTAGGACTACCCCTAGGTCGGACACGTCGTAG
Predicted protein sequences of Glyma04g21753
>Glyma04g21753.1   sequence type=predicted peptide   gene model=Glyma04g21753   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKIALGAARGLACLHVSCKLVHGNIKSSNILFHPTHEACVSDFGLNPIFANPVPLNRVAGYRAPEVQETRKVTFKSDVYSFGVLMLELLTGKAPNQASLSEEGIDLPRWVQSVVREEWTAEVFDAELMRYHNIEEEMVRLLQIAMTCVSLVPDQRPNMDEVVRMIEDISRSETTDDGLRQSSDDPSKGSDGHTPPQDARTTPRSDTS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo