Glyma04g21470 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g21470

Feature Type:	gene_model
Chromosome:	Gm04
Start:	24617570
stop:	24619147
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g21470

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G54680	AT	Annotation by Michelle Graham. TAIR10: basic helix-loop-helix (bHLH) DNA-binding superfamily protein \| chr5:22217270-22218993 FORWARD LENGTH=234	SoyBase	E_val: 5.00E-22	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
UniRef100_G7IKM3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor ILR3 n=1 Tax=Medicago truncatula RepID=G7IKM3_MEDTR	SoyBase	E_val: 1.00E-21	ISS
UniRef100_I1JW87	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JW87_SOYBN	SoyBase	E_val: 5.00E-112	ISS

Expression Patterns of Glyma04g21470

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g21470 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma04g21470

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g21470

Limit To All Plant Sequences

>Glyma04g21470.1   sequence type=CDS   gene model=Glyma04g21470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTCTCGTTAAGGACAAATCATGTGCATCTGGCTCCAAGGCATGTCGTGAGAAATTACAAAGGGATAAACTAAATGAGAGGCATGCTATTATTTTGCATATTGTTTCTGGAATTGAGTTCCATCCTGGAGCCTACGATGCAGCTCGAGTGGTAATCCAATTGAGAAATGAAGCTGAGAGGCTGAAGGAAATGAATGATGAACTACAGGCAAAAGTTAACGAATTGAAGGGTGAGAAGAATGAGCTTCGTGATGAGAACAATAGGTTGAAAGAAGAGAAAGAAAAGTTGGAGCAGCAATGTTTTCTACATCAGTCCTGTCGTAGGCACGACTTTGTTTATCTTGTGTTTCTAAGACGGTCCTTTTACGACCGTTGTAGAAACATCCACCCTCTACAACGTCGTCAATTTCAAAGACGCGCGTCCACCGTCTTTGAAAAGCGTTTTCCACCGTCTTTGAATCCTATTTTTCTAGTAGTGTAA

Predicted protein sequences of Glyma04g21470

Limit To All Plant Sequences

>Glyma04g21470.1   sequence type=predicted peptide   gene model=Glyma04g21470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFLVKDKSCASGSKACREKLQRDKLNERHAIILHIVSGIEFHPGAYDAARVVIQLRNEAERLKEMNDELQAKVNELKGEKNELRDENNRLKEEKEKLEQQCFLHQSCRRHDFVYLVFLRRSFYDRCRNIHPLQRRQFQRRASTVFEKRFPPSLNPIFLVV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain