SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g20860): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g20860): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g20860

Feature Type:gene_model
Chromosome:Gm04
Start:23795594
stop:23796277
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G70730AT Annotation by Michelle Graham. TAIR10: Phosphoglucomutase/phosphomannomutase family protein | chr1:26669020-26672726 REVERSE LENGTH=585 SoyBaseE_val: 3.00E-72ISS
GO:0000023GO-bp Annotation by Michelle Graham. GO Biological Process: maltose metabolic process SoyBaseN/AISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0005992GO-bp Annotation by Michelle Graham. GO Biological Process: trehalose biosynthetic process SoyBaseN/AISS
GO:0006874GO-bp Annotation by Michelle Graham. GO Biological Process: cellular calcium ion homeostasis SoyBaseN/AISS
GO:0009590GO-bp Annotation by Michelle Graham. GO Biological Process: detection of gravity SoyBaseN/AISS
GO:0019252GO-bp Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process SoyBaseN/AISS
GO:0019255GO-bp Annotation by Michelle Graham. GO Biological Process: glucose 1-phosphate metabolic process SoyBaseN/AISS
GO:0019388GO-bp Annotation by Michelle Graham. GO Biological Process: galactose catabolic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0048229GO-bp Annotation by Michelle Graham. GO Biological Process: gametophyte development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0010319GO-cc Annotation by Michelle Graham. GO Cellular Compartment: stromule SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0000287GO-mf Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding SoyBaseN/AISS
GO:0004614GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphoglucomutase activity SoyBaseN/AISS
GO:0016868GO-mf Annotation by Michelle Graham. GO Molecular Function: intramolecular transferase activity, phosphotransferases SoyBaseN/AISS
PTHR22573Panther PHOSPHOHEXOMUTASE FAMILY MEMBER JGI ISS
PTHR22573:SF5Panther PHOSPHOGLUCOMUTASE JGI ISS
PF02880PFAM Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III JGI ISS
UniRef100_G7L9S8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phosphoglucomutase n=2 Tax=Medicago truncatula RepID=G7L9S8_MEDTR SoyBaseE_val: 8.00E-77ISS
UniRef100_I1JL24UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JL24_SOYBN SoyBaseE_val: 2.00E-92ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g20860 not represented in the dataset

Glyma04g20860 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g20860.1   sequence type=CDS   gene model=Glyma04g20860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AGCATGCCAACCTCTGCTGCGCTGGATGTTGTTGCCAAACATCTGAATTTGAAATTTTTTGAGATATATTGCTCTTCAATACATGTCCCCACGGGTCGGAAATTCTTTGGTAATTTAATGGATGCTGGATTATGTTCAGTCTGTGGTGAAGAAAGTTTTGGGACAGGTTCTGACCGTATTCGTGAGAAAGATGGAATCTGGGAAGTTTTGGCCTGGCTATCTATACTTGCATATAAAAATAAAGATAAACTTGAAGACAAGCTTGTCACTGTTGAAGACATAATTCGCCAGCATTGGACTACTTATGGGCGCCATTATTATACTCAATATGACTATGAAAACGTGGATGCAGGTGCAGCAAAGGAACTGATGGCATATTTGGTCAAGCTGCAGTCCTCACTTTCAGAAGTCAATCAGTAT

>Glyma04g20860.1   sequence type=predicted peptide   gene model=Glyma04g20860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SMPTSAALDVVAKHLNLKFFEIYCSSIHVPTGRKFFGNLMDAGLCSVCGEESFGTGSDRIREKDGIWEVLAWLSILAYKNKDKLEDKLVTVEDIIRQHWTTYGRHYYTQYDYENVDAGAAKELMAYLVKLQSSLSEVNQY







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo