|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G70730 | AT | Annotation by Michelle Graham. TAIR10: Phosphoglucomutase/phosphomannomutase family protein | chr1:26669020-26672726 REVERSE LENGTH=585 | SoyBase | E_val: 3.00E-72 | ISS |
| GO:0000023 | GO-bp | Annotation by Michelle Graham. GO Biological Process: maltose metabolic process | SoyBase | N/A | ISS |
| GO:0005975 | GO-bp | Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process | SoyBase | N/A | ISS |
| GO:0005992 | GO-bp | Annotation by Michelle Graham. GO Biological Process: trehalose biosynthetic process | SoyBase | N/A | ISS |
| GO:0006874 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular calcium ion homeostasis | SoyBase | N/A | ISS |
| GO:0009590 | GO-bp | Annotation by Michelle Graham. GO Biological Process: detection of gravity | SoyBase | N/A | ISS |
| GO:0019252 | GO-bp | Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process | SoyBase | N/A | ISS |
| GO:0019255 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glucose 1-phosphate metabolic process | SoyBase | N/A | ISS |
| GO:0019388 | GO-bp | Annotation by Michelle Graham. GO Biological Process: galactose catabolic process | SoyBase | N/A | ISS |
| GO:0046686 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cadmium ion | SoyBase | N/A | ISS |
| GO:0048229 | GO-bp | Annotation by Michelle Graham. GO Biological Process: gametophyte development | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0009570 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma | SoyBase | N/A | ISS |
| GO:0010319 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: stromule | SoyBase | N/A | ISS |
| GO:0048046 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: apoplast | SoyBase | N/A | ISS |
| GO:0000287 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding | SoyBase | N/A | ISS |
| GO:0004614 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: phosphoglucomutase activity | SoyBase | N/A | ISS |
| GO:0016868 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: intramolecular transferase activity, phosphotransferases | SoyBase | N/A | ISS |
| PTHR22573 | Panther | PHOSPHOHEXOMUTASE FAMILY MEMBER | JGI | ISS | |
| PTHR22573:SF5 | Panther | PHOSPHOGLUCOMUTASE | JGI | ISS | |
| PF02880 | PFAM | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III | JGI | ISS | |
| UniRef100_G7L9S8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Phosphoglucomutase n=2 Tax=Medicago truncatula RepID=G7L9S8_MEDTR | SoyBase | E_val: 8.00E-77 | ISS |
| UniRef100_I1JL24 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JL24_SOYBN | SoyBase | E_val: 2.00E-92 | ISS |
|
Glyma04g20860 not represented in the dataset |
Glyma04g20860 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma04g20860.1 sequence type=CDS gene model=Glyma04g20860 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high AGCATGCCAACCTCTGCTGCGCTGGATGTTGTTGCCAAACATCTGAATTTGAAATTTTTTGAGATATATTGCTCTTCAATACATGTCCCCACGGGTCGGAAATTCTTTGGTAATTTAATGGATGCTGGATTATGTTCAGTCTGTGGTGAAGAAAGTTTTGGGACAGGTTCTGACCGTATTCGTGAGAAAGATGGAATCTGGGAAGTTTTGGCCTGGCTATCTATACTTGCATATAAAAATAAAGATAAACTTGAAGACAAGCTTGTCACTGTTGAAGACATAATTCGCCAGCATTGGACTACTTATGGGCGCCATTATTATACTCAATATGACTATGAAAACGTGGATGCAGGTGCAGCAAAGGAACTGATGGCATATTTGGTCAAGCTGCAGTCCTCACTTTCAGAAGTCAATCAGTAT
>Glyma04g20860.1 sequence type=predicted peptide gene model=Glyma04g20860 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high SMPTSAALDVVAKHLNLKFFEIYCSSIHVPTGRKFFGNLMDAGLCSVCGEESFGTGSDRIREKDGIWEVLAWLSILAYKNKDKLEDKLVTVEDIIRQHWTTYGRHYYTQYDYENVDAGAAKELMAYLVKLQSSLSEVNQY
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||