|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
ATCG00480 | AT | Annotation by Michelle Graham. TAIR10: ATP synthase subunit beta | chrC:52660-54156 REVERSE LENGTH=498 | SoyBase | E_val: 7.00E-12 | ISS |
GO:0006091 | GO-bp | Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy | SoyBase | N/A | ISS |
GO:0006354 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation | SoyBase | N/A | ISS |
GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS |
GO:0009817 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to fungus, incompatible interaction | SoyBase | N/A | ISS |
GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
GO:0015986 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ATP synthesis coupled proton transport | SoyBase | N/A | ISS |
GO:0015991 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ATP hydrolysis coupled proton transport | SoyBase | N/A | ISS |
GO:0046034 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ATP metabolic process | SoyBase | N/A | ISS |
GO:0005618 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cell wall | SoyBase | N/A | ISS |
GO:0005754 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial proton-transporting ATP synthase, catalytic core | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0009534 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid | SoyBase | N/A | ISS |
GO:0009535 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane | SoyBase | N/A | ISS |
GO:0009544 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast ATP synthase complex | SoyBase | N/A | ISS |
GO:0009570 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma | SoyBase | N/A | ISS |
GO:0009579 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: thylakoid | SoyBase | N/A | ISS |
GO:0010287 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule | SoyBase | N/A | ISS |
GO:0010319 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: stromule | SoyBase | N/A | ISS |
GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
GO:0016469 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting two-sector ATPase complex | SoyBase | N/A | ISS |
GO:0031977 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen | SoyBase | N/A | ISS |
GO:0033178 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting two-sector ATPase complex, catalytic domain | SoyBase | N/A | ISS |
GO:0045261 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting ATP synthase complex, catalytic core F(1) | SoyBase | N/A | ISS |
GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
GO:0008270 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: zinc ion binding | SoyBase | N/A | ISS |
GO:0008553 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydrogen-exporting ATPase activity, phosphorylative mechanism | SoyBase | N/A | ISS |
GO:0015078 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydrogen ion transmembrane transporter activity | SoyBase | N/A | ISS |
GO:0017111 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity | SoyBase | N/A | ISS |
GO:0046933 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydrogen ion transporting ATP synthase activity, rotational mechanism | SoyBase | N/A | ISS |
GO:0046961 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: proton-transporting ATPase activity, rotational mechanism | SoyBase | N/A | ISS |
PTHR15184 | Panther | ATP SYNTHASE | JGI | ISS | |
PTHR15184:SF23 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
PF00006 | PFAM | ATP synthase alpha/beta family, nucleotide-binding domain | JGI | ISS | |
UniRef100_D4HLZ8 | UniRef | Annotation by Michelle Graham. Best UniRef hit: ATP synthase beta subunit (Fragment) n=1 Tax=Bachelotia antillarum RepID=D4HLZ8_9PHAE | SoyBase | E_val: 1.00E-09 | ISS |
UniRef100_D4HLZ8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: ATP synthase beta subunit (Fragment) n=1 Tax=Bachelotia antillarum RepID=D4HLZ8_9PHAE | SoyBase | E_val: 1.00E-09 | ISS |
Glyma04g20640 not represented in the dataset |
Glyma04g20640 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma04g20640.1 sequence type=CDS gene model=Glyma04g20640 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATTTTTGAAACAGGAATAAAAGTAGTAGATCTTTTAGTTTCTTATAGTCGTGGAGGAAAAATAGGACTTTTTGGTGGAGCTGGAGTGGGTAAAATG
>Glyma04g20640.1 sequence type=predicted peptide gene model=Glyma04g20640 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high IFETGIKVVDLLVSYSRGGKIGLFGGAGVGKM
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||