SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g19870

Feature Type:gene_model
Chromosome:Gm04
Start:21678793
stop:21679996
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g19870
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G15760AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 10 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G52565.1); Has 42 Blast hits to 42 proteins in 10 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 42; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr3:5337734-5338219 FORWARD LENGTH=135 SoyBaseE_val: 3.00E-17ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009646GO-bp Annotation by Michelle Graham. GO Biological Process: response to absence of light SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_UPI000233A9B3UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A9B3 related cluster n=1 Tax=unknown RepID=UPI000233A9B3 SoyBaseE_val: 5.00E-95ISS

Expression Patterns of Glyma04g19870
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g19870 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g147200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g19870
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g19870
>Glyma04g19870.2   sequence type=CDS   gene model=Glyma04g19870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTTCAATGATAACCTCACAAGGGGTGCTCTTAGCCACCGCCATGGCCGTCTCAGGCACAGTCATCGTTCTTGCTCTGCGCCTCCAACGATCTTTCCTAGCCATCCAATTCCCGGTTCATGAAATTTCTCACCCATCTACTCCAATTCTGCGATCTTGCATATCCTCAGTTCGGAACAAGAGGGAGAAGAAGAGGGTGCACTTTGCGGATGATGTGGTGGATTCATGTGGGGACGGAGAAGAGTTCAGGAGGCAGCAACGTGTTAATAGAAACTTTTGGTGTTCAAAATCAGAATCTAAGGTTCGGAAGAATTGTGAAGGCAAGAGTGATGTTAGAGGAATGCCAGCTAATAGGGTAGCCCTCTATAATGGAATTCTCAGGGATCGTGTGGCCCAAAGAATGACTTACTCGTACTGA
Predicted protein sequences of Glyma04g19870
>Glyma04g19870.2   sequence type=predicted peptide   gene model=Glyma04g19870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSMITSQGVLLATAMAVSGTVIVLALRLQRSFLAIQFPVHEISHPSTPILRSCISSVRNKREKKRVHFADDVVDSCGDGEEFRRQQRVNRNFWCSKSESKVRKNCEGKSDVRGMPANRVALYNGILRDRVAQRMTYSY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo