SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g19240): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g19240): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g19240

Feature Type:gene_model
Chromosome:Gm04
Start:21030320
stop:21031092
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g19240
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G15430AT Annotation by Michelle Graham. TAIR10: Regulator of chromosome condensation (RCC1) family protein | chr3:5209408-5211562 FORWARD LENGTH=488 SoyBaseE_val: 4.00E-73ISS
GO:0006486GO-bp Annotation by Michelle Graham. GO Biological Process: protein glycosylation SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0008536GO-mf Annotation by Michelle Graham. GO Molecular Function: Ran GTPase binding SoyBaseN/AISS
PTHR22870Panther REGULATOR OF CHROMOSOME CONDENSATION JGI ISS
PTHR22870:SF24Panther UNCHARACTERIZED JGI ISS
PF00415PFAM Regulator of chromosome condensation (RCC1) repeat JGI ISS
UniRef100_B9SRF4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ran GTPase binding protein, putative n=1 Tax=Ricinus communis RepID=B9SRF4_RICCO SoyBaseE_val: 7.00E-72ISS
UniRef100_I1LUZ0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LUZ0_SOYBN SoyBaseE_val: 1.00E-88ISS

Expression Patterns of Glyma04g19240
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g19240 not represented in the dataset
Glyma04g19240 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g19240 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma04g19240
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g19240
>Glyma04g19240.1   sequence type=CDS   gene model=Glyma04g19240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AGGAAAGGTATTCATATTGTCTGTGTATCTGCAGGGGATGAGCATGCAGTGGCACTTGATTCAAATGGATTTGTATATACATGGGGCAAGGGATACTGTGGTGCTTTAGGCCATGGGGATGAGATTGAGAAGACAACTCCAGAGTTGTTGACTAATCAAATGGTTTACAATAAGAAAACGTATTTGGTTTTTCTAGATCAAGTCTTTATTGTCTGTGCAAGGAAGAGGAAAACATTTGTTCTAGTTAATTCTGGTTTAGTCTATGGCTTTGGCTCCATGGGATTTGGCAGCCTCGGATTCCTGTATAGAAGGGTATCTAATAAAGTATTGAAACCTAGAATCTTAGATACCTTGGGAGCTCACCATGTTTCTCAAATTAGCACTGGCTTGTACAACACTGTGGTGATCACTAGCAGGGGACAAATATTTGGCTTTGGAGACAATGAAAGAGCACAACTTGGTCATGACACATTAATAAGCTACCTAGAGCCCACTCAAATTTTCATT
Predicted protein sequences of Glyma04g19240
>Glyma04g19240.1   sequence type=predicted peptide   gene model=Glyma04g19240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
RKGIHIVCVSAGDEHAVALDSNGFVYTWGKGYCGALGHGDEIEKTTPELLTNQMVYNKKTYLVFLDQVFIVCARKRKTFVLVNSGLVYGFGSMGFGSLGFLYRRVSNKVLKPRILDTLGAHHVSQISTGLYNTVVITSRGQIFGFGDNERAQLGHDTLISYLEPTQIFI






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo