|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G45690 | AT | Annotation by Michelle Graham. TAIR10: shrunken seed protein (SSE1) | chr2:18823465-18825601 REVERSE LENGTH=367 | SoyBase | E_val: 5.00E-48 | ISS |
| GO:0006633 | GO-bp | Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0006635 | GO-bp | Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation | SoyBase | N/A | ISS |
| GO:0007031 | GO-bp | Annotation by Michelle Graham. GO Biological Process: peroxisome organization | SoyBase | N/A | ISS |
| GO:0005777 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: peroxisome | SoyBase | N/A | ISS |
| GO:0005789 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum membrane | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| PTHR13299 | Panther | UNCHARACTERIZED | JGI | ISS | |
| PF08610 | PFAM | Peroxisomal membrane protein (Pex16) | JGI | ISS | |
| UniRef100_I1JW55 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JW55_SOYBN | SoyBase | E_val: 1.00E-81 | ISS |
| UniRef100_Q8S8S1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Peroxisome biogenesis protein 16 n=1 Tax=Arabidopsis thaliana RepID=PEX16_ARATH | SoyBase | E_val: 3.00E-45 | ISS |
|
Glyma04g18520 not represented in the dataset |
Glyma04g18520 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.04g148600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma04g18520.1 sequence type=CDS gene model=Glyma04g18520 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGATGTTAAACATTAGACCACTTATTTATGTTTTATTTATTGGAAAATATGGTATTCGATCATGGACCCCTTGGTTCCTTTTGCTGGCTATTGATTGCATAGGAAACAGTATTCTTTCACTCATTACATCGTTAGTGGCTGGTGGGAAGGACCGAATGTTTCATCTGTCTGCCCCAGAAAAGGATGAGGTTAAACGGCGAAAGCTACTATTTGTTCTTTACCTAATGAGAGATCCATTTTTCAGCAAGTATACTAGGCAAAGAATTGAAAGCACGGAGAAAGTTTTGGAGCCTATTCCTGTCATAGGATTTCTCACAGCAAAACTTGTTGAACTTATAATTGGAGCTCAAACACGATACACTTACATGTCAGGATCGTGA
>Glyma04g18520.1 sequence type=predicted peptide gene model=Glyma04g18520 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MMLNIRPLIYVLFIGKYGIRSWTPWFLLLAIDCIGNSILSLITSLVAGGKDRMFHLSAPEKDEVKRRKLLFVLYLMRDPFFSKYTRQRIESTEKVLEPIPVIGFLTAKLVELIIGAQTRYTYMSGS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||