SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g17691): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g17691): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g17691

Feature Type:gene_model
Chromosome:Gm04
Start:19209043
stop:19211110
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g17691
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G33690AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: pollen tube; Has 543 Blast hits to 512 proteins in 106 species: Archae - 0; Bacteria - 0; Metazoa - 281; Fungi - 54; Plants - 72; Viruses - 0; Other Eukaryotes - 136 (source: NCBI BLink). | chr4:16175198-16176137 FORWARD LENGTH=246 SoyBaseE_val: 1.00E-30ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
UniRef100_C6TAT6UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TAT6_SOYBN SoyBaseE_val: 2.00E-39ISS
UniRef100_D7MGG9UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT4g33690/T16L1_180 n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7MGG9_ARALL SoyBaseE_val: 3.00E-28ISS

Expression Patterns of Glyma04g17691
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g17691 not represented in the dataset
Glyma04g17691 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g17691 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma04g17691
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g17691
>Glyma04g17691.1   sequence type=CDS   gene model=Glyma04g17691   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTATTCATTCAATTAAAGTCTCATTCCTATTGTTCTTTCTTTTGTGTAATATGTTCAGTCACTCAAATGGATTTGGAGACGGAAAACAGATTAGCTGCTATGCTTATGAGGGAAGTAGCAGAATTACGGCGACAGTCTAAAAGGGAAGGAGTTCTGGCTTATCTTCGCAAGCCTAATATACGGACCCGACCAAATTCATGTTTCCTCATTGCAACTGTTCGTGGAGTACAACAAGCAAATCGAGTTGTGGAAGTGAATGAGATGTGGCGACTGAGGCAAAAAGAGGATATAGGAAGGCAGGTATTGACTTATGGAGAAAGTCACCAATGTATCTCCTGCTCTTTCAAGGAGGGACATGGCCATGCAAATGAGCCTAGAGGCTAG
Predicted protein sequences of Glyma04g17691
>Glyma04g17691.1   sequence type=predicted peptide   gene model=Glyma04g17691   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLFIQLKSHSYCSFFCVICSVTQMDLETENRLAAMLMREVAELRRQSKREGVLAYLRKPNIRTRPNSCFLIATVRGVQQANRVVEVNEMWRLRQKEDIGRQVLTYGESHQCISCSFKEGHGHANEPRG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo