SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g17660): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g17660): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g17660

Feature Type:gene_model
Chromosome:Gm04
Start:19173503
stop:19173937
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G42380AT Annotation by Michelle Graham. TAIR10: calmodulin like 37 | chr5:16942758-16943315 REVERSE LENGTH=185 SoyBaseE_val: 3.00E-24ISS
GO:0009693GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene biosynthetic process SoyBaseN/AISS
GO:0010193GO-bp Annotation by Michelle Graham. GO Biological Process: response to ozone SoyBaseN/AISS
GO:0010286GO-bp Annotation by Michelle Graham. GO Biological Process: heat acclimation SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0052542GO-bp Annotation by Michelle Graham. GO Biological Process: defense response by callose deposition SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005509GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium ion binding SoyBaseN/AISS
KOG0027 KOG Calmodulin and related proteins (EF-Hand superfamily) JGI ISS
PTHR10891Panther CALMODULIN JGI ISS
PTHR10891:SF39Panther EF-HAND CALCIUM BINDING PROTEIN JGI ISS
UniRef100_G7J5J1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Calmodulin-like protein n=2 Tax=Medicago truncatula RepID=G7J5J1_MEDTR SoyBaseE_val: 3.00E-49ISS
UniRef100_UPI000233A99EUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A99E related cluster n=1 Tax=unknown RepID=UPI000233A99E SoyBaseE_val: 2.00E-91ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g17660 not represented in the dataset

Glyma04g17660 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g136300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g17660.1   sequence type=CDS   gene model=Glyma04g17660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGGTGAACACAGAGTTTGAGCGCGTTCTTAAGTATTTCAATGAAGATGGGGATGGTAAGATTTCCCCATCTGAGCTTAGGAACCGGCTAGGCATGATGGGTGGTGAGTTATTGTTCAAAGACGCTGAAAAGTTGATTGAGGAATTGGATTCTGACGGTGATGGGCTTTTGAGTTTGGAAAATTTTGTGAAGATAATGGAGGATGCTGGGGAAGAGAAGTTGAAGGATTTGGCAGAGGCTTTTGAGATGTACCGTAACACTGAAATGTATGGGTTTATAACAACCAAAAGCTTGCAAAGGATGCTGCGTAGGTTAGGAGAATCAAAATCCATGGAGCAATGCACAACTATGATTGACCACTTTGATTTGAATGGAGATGGCCTGCTTGTAAAACAATTAAGGTTTTCTAGATTATTAATTATAGGAAATTAA

>Glyma04g17660.1   sequence type=predicted peptide   gene model=Glyma04g17660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRVNTEFERVLKYFNEDGDGKISPSELRNRLGMMGGELLFKDAEKLIEELDSDGDGLLSLENFVKIMEDAGEEKLKDLAEAFEMYRNTEMYGFITTKSLQRMLRRLGESKSMEQCTTMIDHFDLNGDGLLVKQLRFSRLLIIGN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo