Glyma04g17310 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g17310): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g17310): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g17310

Feature Type:	gene_model
Chromosome:	Gm04
Start:	18779621
stop:	18787193
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g17310

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G06730	AT	Annotation by Michelle Graham. TAIR10: Thioredoxin z \| chr3:2124276-2125845 FORWARD LENGTH=183	SoyBase	E_val: 1.00E-80	ISS
GO:0006364	GO-bp	Annotation by Michelle Graham. GO Biological Process: rRNA processing	SoyBase	N/A	ISS
GO:0006399	GO-bp	Annotation by Michelle Graham. GO Biological Process: tRNA metabolic process	SoyBase	N/A	ISS
GO:0006662	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycerol ether metabolic process	SoyBase	N/A	ISS
GO:0009657	GO-bp	Annotation by Michelle Graham. GO Biological Process: plastid organization	SoyBase	N/A	ISS
GO:0009658	GO-bp	Annotation by Michelle Graham. GO Biological Process: chloroplast organization	SoyBase	N/A	ISS
GO:0042793	GO-bp	Annotation by Michelle Graham. GO Biological Process: transcription from plastid promoter	SoyBase	N/A	ISS
GO:0045036	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to chloroplast	SoyBase	N/A	ISS
GO:0045454	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009295	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleoid	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009579	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
GO:0015035	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity	SoyBase	N/A	ISS
GO:0047134	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein-disulfide reductase activity	SoyBase	N/A	ISS
KOG0907	KOG	Thioredoxin	JGI		ISS
PTHR10438	Panther	THIOREDOXIN-RELATED	JGI		ISS
PTHR10438:SF74	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00085	PFAM	Thioredoxin	JGI		ISS
UniRef100_I1JW39	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JW39_SOYBN	SoyBase	E_val: 3.00E-140	ISS
UniRef100_Q9M7X9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Thioredoxin-like protein CITRX, chloroplastic n=1 Tax=Arabidopsis thaliana RepID=CITRX_ARATH	SoyBase	E_val: 5.00E-78	ISS

Expression Patterns of Glyma04g17310

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g17310 not represented in the dataset	Glyma04g17310 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g17310 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g135300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g17310

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma04g17310

Limit To All Plant Sequences

>Glyma04g17310.2   sequence type=transcript   gene model=Glyma04g17310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAGAAAATTTGTAAGTCCAAACTAGATATGGTAATTGGTAAACCCCTACACTCAAAAACCCTCTTTTCCATTCAATACACTCTTCCAATTCCAATCCAAACCAACAGCAATGTCTCTGTTCTTACATTGCCATGCCCCTCACCACAGCATGGCCACTCTCTCACCCTTCTCAACCTTCAATTCCAAACCTCTCTGTGCTTCTCTACCTAACCCCTCTTTCTTAACTCATCAACAACAGCAACAACACCCTTATCCTCTCACCACAACGACCACCTCTGACCATAAGCCCCTCTCAGTTTCCACACTGCCCAGAAAGTTGCTCTGTAAACCACCCAAAGGAAAGTACGTCAGAGAGGACTATCTTGTGAAAAAGTTGTCAGCTCAGGAAATCCAGGAGCTGGTAAAGGGAGAAAGAAAAGTGCCTCTTATTATTGATTTCTATGCAACTTGGTGTGGACCATGCATTTTAATGGCACAAGAACTTGAAACAGTATGTGATGTTGGTTTAGTTGATGTAGAAAATGCTTAACCATTGCTCTGATTTGACTACGAGGATGTGATGTTGGTTTCTACTTTCAATATAGCACAATGTGTCTGATGTTTTATTTCAATCTTTACTTATATCACCCTCCAAGAAAGAAGATAGTGGATAGGATGGCTAATATGAGTCTTTAATTGTGTTTAAACTTCATGTTATGAAATAGATTAAATTCCATTCACCAAAAAATAGATTAGTTTACTTAAAATATTTGACGGAGATTTGCCTATAAGTAAAACAGGCAGCTGGTTTGGAAGCTTGGAAATTCAATTGTTAACAAAAATTGGCTCTCAATTATTCGCAGAAACTAACCGTTATTGTTGTAATTGGATGCTGATGGAGATATAATGGAATATCTTATATTTTGTTT

Coding sequences of Glyma04g17310

Limit To All Plant Sequences

>Glyma04g17310.1   sequence type=CDS   gene model=Glyma04g17310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTCTGTTCTTACATTGCCATGCCCCTCACCACAGCATGGCCACTCTCTCACCCTTCTCAACCTTCAATTCCAAACCTCTCTGTGCTTCTCTACCTAACCCCTCTTTCTTAACTCATCAACAACAGCAACAACACCCTTATCCTCTCACCACAACGACCACCTCTGACCATAAGCCCCTCTCAGTTTCCACACTGCCCAGAAAGTTGCTCTGTAAACCACCCAAAGGAAAGTACGTCAGAGAGGACTATCTTGTGAAAAAGTTGTCAGCTCAGGAAATCCAGGAGCTGGTAAAGGGAGAAAGAAAAGTGCCTCTTATTATTGATTTCTATGCAACTTGGTGTGGACCATGCATTTTAATGGCACAAGAACTTGAAACACTTGCAGTTGAGTACCAAAACAAGGCGCTGATTGTTAAAGTTGATACAGATGACGAGTATGAATTTGCACGCGACATGCAGGTTCGCGGTTTGCCTACTGTGTTCTTTATTAGCCCTGATCTGAACAAAGAAGCTATTCGAACCGAAGGACTTCTCCCAATACAGATGATGAGGGATATCATTGACAAGGATATGTGA

>Glyma04g17310.2   sequence type=CDS   gene model=Glyma04g17310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTCTGTTCTTACATTGCCATGCCCCTCACCACAGCATGGCCACTCTCTCACCCTTCTCAACCTTCAATTCCAAACCTCTCTGTGCTTCTCTACCTAACCCCTCTTTCTTAACTCATCAACAACAGCAACAACACCCTTATCCTCTCACCACAACGACCACCTCTGACCATAAGCCCCTCTCAGTTTCCACACTGCCCAGAAAGTTGCTCTGTAAACCACCCAAAGGAAAGTACGTCAGAGAGGACTATCTTGTGAAAAAGTTGTCAGCTCAGGAAATCCAGGAGCTGGTAAAGGGAGAAAGAAAAGTGCCTCTTATTATTGATTTCTATGCAACTTGGTGTGGACCATGCATTTTAATGGCACAAGAACTTGAAACAGTATGTGATGTTGGTTTAGTTGATGTAGAAAATGCTTAA

Predicted protein sequences of Glyma04g17310

Limit To All Plant Sequences

>Glyma04g17310.1   sequence type=predicted peptide   gene model=Glyma04g17310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSLFLHCHAPHHSMATLSPFSTFNSKPLCASLPNPSFLTHQQQQQHPYPLTTTTTSDHKPLSVSTLPRKLLCKPPKGKYVREDYLVKKLSAQEIQELVKGERKVPLIIDFYATWCGPCILMAQELETLAVEYQNKALIVKVDTDDEYEFARDMQVRGLPTVFFISPDLNKEAIRTEGLLPIQMMRDIIDKDM*

>Glyma04g17310.2   sequence type=predicted peptide   gene model=Glyma04g17310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSLFLHCHAPHHSMATLSPFSTFNSKPLCASLPNPSFLTHQQQQQHPYPLTTTTTSDHKPLSVSTLPRKLLCKPPKGKYVREDYLVKKLSAQEIQELVKGERKVPLIIDFYATWCGPCILMAQELETVCDVGLVDVENA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain