Glyma04g16880 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g16880

Feature Type:	gene_model
Chromosome:	Gm04
Start:	18063821
stop:	18064204
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g16880

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
PF05678	PFAM	VQ motif	JGI		ISS
UniRef100_D1MWZ4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Sigma factor binding protein 1 n=1 Tax=Citrullus lanatus subsp. vulgaris RepID=D1MWZ4_CITLA	SoyBase	E_val: 1.00E-09	ISS
UniRef100_I1JW30	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JW30_SOYBN	SoyBase	E_val: 3.00E-89	ISS

Proteins Associated with Glyma04g16880

Locus	Gene Symbol	Protein Name
	VQ12	VQ motif containing protein gene 12

Expression Patterns of Glyma04g16880

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g16880 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g134200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g16880

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g16880

Limit To All Plant Sequences

>Glyma04g16880.1   sequence type=CDS   gene model=Glyma04g16880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTGGCGTTAATAACAACCATGCTGTGATGAAGAGAAAAGGGCAGAGCAAAAGGGGTCACAAGAAGAACGTTAAAGTCACATATATTTCAAGCCCCATGAAGGTGAAGACTAGTGCCTCAAACTTCAGAGCACTTGTGCAAGAGCTCACAGGCCAAGCCTCCAATGTTGCTGAAATGTTCGTGGAAGCTGATTATTATTATGGTGTGCATCATGATGATGGAGTTCACAAGGGCAATCAACAATGGAGTAGTGAGGAGGCATATTTTCCCGAGTCTACTTGGTTGAAACATGATGATTATAGCCACTTGAATTCGAGGTCCTCCATGGAGCTACTAACCGAACATCTTGAACTTGAACTTTTGAGCTTTGGTATGCAGTAG

Predicted protein sequences of Glyma04g16880

Limit To All Plant Sequences

>Glyma04g16880.1   sequence type=predicted peptide   gene model=Glyma04g16880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLGVNNNHAVMKRKGQSKRGHKKNVKVTYISSPMKVKTSASNFRALVQELTGQASNVAEMFVEADYYYGVHHDDGVHKGNQQWSSEEAYFPESTWLKHDDYSHLNSRSSMELLTEHLELELLSFGMQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain