Glyma04g16760 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g16760): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g16760): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g16760

Feature Type:	gene_model
Chromosome:	Gm04
Start:	17873911
stop:	17877548
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g16760

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G80190	AT	Annotation by Michelle Graham. TAIR10: partner of SLD five 1 \| chr1:30159476-30161115 FORWARD LENGTH=201	SoyBase	E_val: 1.00E-96	ISS
GO:0006261	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA-dependent DNA replication	SoyBase	N/A	ISS
GO:0006270	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA replication initiation	SoyBase	N/A	ISS
GO:0000811	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: GINS complex	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG3303	KOG	Predicted alpha-helical protein, potentially involved in replication/repair	JGI		ISS
PTHR12914	Panther	PARTNER OF SLD5	JGI		ISS
PF05916	PFAM	GINS complex subunit Sld5	JGI		ISS
UniRef100_G7IYB5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DNA replication complex GINS protein PSF1 n=1 Tax=Medicago truncatula RepID=G7IYB5_MEDTR	SoyBase	E_val: 2.00E-108	ISS
UniRef100_I1JW26	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JW26_SOYBN	SoyBase	E_val: 8.00E-146	ISS

Expression Patterns of Glyma04g16760

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g16760 not represented in the dataset	Glyma04g16760 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g16760 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g133700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g16760

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g16760

Limit To All Plant Sequences

>Glyma04g16760.1   sequence type=CDS   gene model=Glyma04g16760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTACGGGAGTAAAGCTAGTCAACTTGTGAAAGAATTTGCAAGTGGAGAAAAAGGTCAGCTTACCACATACAATAATGACTTGATTCGAGAAGTAGTTGCAGAGTGTACTCAACATCACCTTGATTTTCAGTCCTTGATAAGGAAGATGCAGGAAGAAGGTTTGGATATCCAAACGGCAAAAAATGCAGATCACTATGGAGCCCTTATCCACCATCTTGCTGTAGTCCGAAATAAACGTTGCCTAATGGCCTATATGTATAATCGAGCAGAAATTATACGAAACTTGTTATGGAAGATAGGGCATGTGCTTCCTCAAGAAATTAAAGTGAAGCTTTGTAATACGGAGGAAGAACATTTCAAGAATCATTCTAAAGCACTGAAAAATTATATGTTGAAAGTGGAGGTTGATTTGACTGTGGATATGGTACCGCCAAAAGATCCATACATCAAAGTGAGGGTCATTGATGACATTGGAGAAGGCATTCTGCTCAGTGATGATAAGAGTGCCAATTTTGCCCTCCATTCAATGCACCTTCTGAAGCGAACTGATGCAGAGCAATTTATCGCACAGGGAAAAATGGAAGAGCTCACGGGTTGA

Predicted protein sequences of Glyma04g16760

Limit To All Plant Sequences

>Glyma04g16760.1   sequence type=predicted peptide   gene model=Glyma04g16760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYGSKASQLVKEFASGEKGQLTTYNNDLIREVVAECTQHHLDFQSLIRKMQEEGLDIQTAKNADHYGALIHHLAVVRNKRCLMAYMYNRAEIIRNLLWKIGHVLPQEIKVKLCNTEEEHFKNHSKALKNYMLKVEVDLTVDMVPPKDPYIKVRVIDDIGEGILLSDDKSANFALHSMHLLKRTDAEQFIAQGKMEELTG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain