SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g16760): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g16760): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g16760

Feature Type:gene_model
Chromosome:Gm04
Start:17873911
stop:17877548
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G80190AT Annotation by Michelle Graham. TAIR10: partner of SLD five 1 | chr1:30159476-30161115 FORWARD LENGTH=201 SoyBaseE_val: 1.00E-96ISS
GO:0006261GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent DNA replication SoyBaseN/AISS
GO:0006270GO-bp Annotation by Michelle Graham. GO Biological Process: DNA replication initiation SoyBaseN/AISS
GO:0000811GO-cc Annotation by Michelle Graham. GO Cellular Compartment: GINS complex SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG3303 KOG Predicted alpha-helical protein, potentially involved in replication/repair JGI ISS
PTHR12914Panther PARTNER OF SLD5 JGI ISS
PF05916PFAM GINS complex subunit Sld5 JGI ISS
UniRef100_G7IYB5UniRef Annotation by Michelle Graham. Most informative UniRef hit: DNA replication complex GINS protein PSF1 n=1 Tax=Medicago truncatula RepID=G7IYB5_MEDTR SoyBaseE_val: 2.00E-108ISS
UniRef100_I1JW26UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JW26_SOYBN SoyBaseE_val: 8.00E-146ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g16760 not represented in the dataset

Glyma04g16760 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g133700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g16760.1   sequence type=CDS   gene model=Glyma04g16760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTACGGGAGTAAAGCTAGTCAACTTGTGAAAGAATTTGCAAGTGGAGAAAAAGGTCAGCTTACCACATACAATAATGACTTGATTCGAGAAGTAGTTGCAGAGTGTACTCAACATCACCTTGATTTTCAGTCCTTGATAAGGAAGATGCAGGAAGAAGGTTTGGATATCCAAACGGCAAAAAATGCAGATCACTATGGAGCCCTTATCCACCATCTTGCTGTAGTCCGAAATAAACGTTGCCTAATGGCCTATATGTATAATCGAGCAGAAATTATACGAAACTTGTTATGGAAGATAGGGCATGTGCTTCCTCAAGAAATTAAAGTGAAGCTTTGTAATACGGAGGAAGAACATTTCAAGAATCATTCTAAAGCACTGAAAAATTATATGTTGAAAGTGGAGGTTGATTTGACTGTGGATATGGTACCGCCAAAAGATCCATACATCAAAGTGAGGGTCATTGATGACATTGGAGAAGGCATTCTGCTCAGTGATGATAAGAGTGCCAATTTTGCCCTCCATTCAATGCACCTTCTGAAGCGAACTGATGCAGAGCAATTTATCGCACAGGGAAAAATGGAAGAGCTCACGGGTTGA

>Glyma04g16760.1   sequence type=predicted peptide   gene model=Glyma04g16760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYGSKASQLVKEFASGEKGQLTTYNNDLIREVVAECTQHHLDFQSLIRKMQEEGLDIQTAKNADHYGALIHHLAVVRNKRCLMAYMYNRAEIIRNLLWKIGHVLPQEIKVKLCNTEEEHFKNHSKALKNYMLKVEVDLTVDMVPPKDPYIKVRVIDDIGEGILLSDDKSANFALHSMHLLKRTDAEQFIAQGKMEELTG*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo