SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma04g16540

Feature Type:gene_model
Chromosome:Gm04
Start:17654735
stop:17655189
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
UniRef100_G7KDX9UniRef Annotation by Michelle Graham. Most informative UniRef hit: CCP n=1 Tax=Medicago truncatula RepID=G7KDX9_MEDTR SoyBaseE_val: 4.00E-09ISS
UniRef100_I1JW19UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JW19_SOYBN SoyBaseE_val: 7.00E-34ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g16540 not represented in the dataset

Glyma04g16540 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g132600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g16540.1   sequence type=CDS   gene model=Glyma04g16540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACATTTCACGGAATTCTATGGTTAAATTGACATTCTTATTTGCTTTCTTTATCATTGCATCAGATATGTGCATGAAATTGGAGGCAAGAGGACCCATTGCGCATTGGAACTGTGATAACGACTCGCAGTGCCAATTTACTTGTCCAACTTGTGGTTGCAGATGCATAAACACATGGTGTCAGTGTCCAACACCACCTTTCACCGATAATATTCATATTCAAGCACCCGAAATTGAGTAA

>Glyma04g16540.1   sequence type=predicted peptide   gene model=Glyma04g16540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDISRNSMVKLTFLFAFFIIASDMCMKLEARGPIAHWNCDNDSQCQFTCPTCGCRCINTWCQCPTPPFTDNIHIQAPEIE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo