Glyma04g16290 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g16290): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g16290): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g16290

Feature Type:	gene_model
Chromosome:	Gm04
Start:	17396910
stop:	17398397
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g16290

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G75280	AT	Annotation by Michelle Graham. TAIR10: NmrA-like negative transcriptional regulator family protein \| chr1:28252030-28253355 FORWARD LENGTH=310	SoyBase	E_val: 3.00E-42	ISS
GO:0006979	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to oxidative stress	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
PTHR10366	Panther	NAD DEPENDENT EPIMERASE/DEHYDRATASE	JGI		ISS
PTHR10366:SF62	Panther	EPIMERASE-RELATED	JGI		ISS
PF05368	PFAM	NmrA-like family	JGI		ISS
UniRef100_G7IVJ4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Eugenol synthase n=1 Tax=Medicago truncatula RepID=G7IVJ4_MEDTR	SoyBase	E_val: 3.00E-98	ISS
UniRef100_UPI000233A832	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233A832 related cluster n=1 Tax=unknown RepID=UPI000233A832	SoyBase	E_val: 1.00E-131	ISS

Expression Patterns of Glyma04g16290

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g16290 not represented in the dataset	Glyma04g16290 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g16290 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g131200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g16290

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g16290

Limit To All Plant Sequences

>Glyma04g16290.2   sequence type=CDS   gene model=Glyma04g16290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AGATTCCTTCCGTCAAATTTTCGGGTGGAAGAGGATAGAGTAAACCCTCTTCCTCCGTTTCAAGCTGTTCTCGATAAGAAAAGAAAAATTAGAAGGAAAATTGAAGCAGTTGGGATCCCTTATACCTTTGTCTCTGCAAATTGTTTTGGTGCATACTTTGTTAATTATTTGCTTCGTTCTTATGAGAAAAAGAACAATATTACTGTCTATGGCAACAGTGATACCAAAGCTGTGCTAAATTATGAAGAAGATATCGCCATGTACACTATTAAAGTAGCAAATGATCCAAGAACATGCAATCGTGTTGTTACTTACCCACCATCGAAGAATATCATATCACAAAATGAGTTGATATCATTGTGGGAGCAAAAAGGTGCCTTACCCCCTCCACACAATATTCCAGTTCCCATTCTTCATAGTGTATTTGTTAGAGGGGACCTCGTGAACTTTGAGCTACGGGAAAATGACCTTGAAGCTTCAAGCCTATATCCTGATTATAACTACACATCAATTCATAAACTTCTTGATATATTTCTTGCTAATCCTCCAACCCCTGCCTCTGCTGCTTTTGAGTGA

Predicted protein sequences of Glyma04g16290

Limit To All Plant Sequences

>Glyma04g16290.2   sequence type=predicted peptide   gene model=Glyma04g16290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
RFLPSNFRVEEDRVNPLPPFQAVLDKKRKIRRKIEAVGIPYTFVSANCFGAYFVNYLLRSYEKKNNITVYGNSDTKAVLNYEEDIAMYTIKVANDPRTCNRVVTYPPSKNIISQNELISLWEQKGALPPPHNIPVPILHSVFVRGDLVNFELRENDLEASSLYPDYNYTSIHKLLDIFLANPPTPASAAFE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain