|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G65790 | AT | Annotation by Michelle Graham. TAIR10: receptor kinase 1 | chr1:24468932-24472329 FORWARD LENGTH=843 | SoyBase | E_val: 5.00E-31 | ISS |
| GO:0006468 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein phosphorylation | SoyBase | N/A | ISS |
| GO:0046777 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein autophosphorylation | SoyBase | N/A | ISS |
| GO:0048544 | GO-bp | Annotation by Michelle Graham. GO Biological Process: recognition of pollen | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0004672 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein kinase activity | SoyBase | N/A | ISS |
| GO:0004674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0016301 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: kinase activity | SoyBase | N/A | ISS |
| GO:0016772 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups | SoyBase | N/A | ISS |
| GO:0019199 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transmembrane receptor protein kinase activity | SoyBase | N/A | ISS |
| GO:0030246 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: carbohydrate binding | SoyBase | N/A | ISS |
| PTHR24420 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PTHR24420:SF430 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
| PF00069 | PFAM | Protein kinase domain | JGI | ISS | |
| UniRef100_G7IVB2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Serine/threonine protein kinase n=1 Tax=Medicago truncatula RepID=G7IVB2_MEDTR | SoyBase | E_val: 1.00E-54 | ISS |
| UniRef100_G7IVB2 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Serine/threonine protein kinase n=1 Tax=Medicago truncatula RepID=G7IVB2_MEDTR | SoyBase | E_val: 1.00E-54 | ISS |
|
Glyma04g16153 not represented in the dataset |
Glyma04g16153 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.04g130000 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma04g16153.1 sequence type=CDS gene model=Glyma04g16153 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTTACTCTATGAATATATGTCCAACAAAAGCCTAGATTCATTTCTTTTTGATCCAACTCAAAGTAAACTTCTAGATTGGTCTACACGCTTCCATATCATAGATCTAAAAGCAAGTAACATTTTGTTAGACAATGATATGAATCCAAAATTTTCAGATTTTGACTTAGCAAGACTTTGTGGAGATGATCAAATTGAAGGGAATAGAAATAGAGCATGCAGAACGTGGAAAAAAGGAAATCTAATAGAATTGATTGATGATTGTCTGGGGGACTTGTATGTTATATCAGAAGCCTTACGTTGCATACAAGTTGGTCTTTTATGTATACAACATCATCCATATGATAGGCCTAACACGGCATCAGTGGTTGTTATGTTGACAAACGAAACTATTTTAGCTCAACCAAAGGAGCCTGGTTTCTTATTAGAAACCTAG
>Glyma04g16153.1 sequence type=predicted peptide gene model=Glyma04g16153 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLLYEYMSNKSLDSFLFDPTQSKLLDWSTRFHIIDLKASNILLDNDMNPKFSDFDLARLCGDDQIEGNRNRACRTWKKGNLIELIDDCLGDLYVISEALRCIQVGLLCIQHHPYDRPNTASVVVMLTNETILAQPKEPGFLLET*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||