Glyma04g15930 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g15930

Feature Type:	gene_model
Chromosome:	Gm04
Start:	16842145
stop:	16843001
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g15930

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G68620	AT	Annotation by Michelle Graham. TAIR10: alpha/beta-Hydrolases superfamily protein \| chr1:25766018-25767028 FORWARD LENGTH=336	SoyBase	E_val: 1.00E-44	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0009407	GO-bp	Annotation by Michelle Graham. GO Biological Process: toxin catabolic process	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0010583	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0016787	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity	SoyBase	N/A	ISS
KOG1515	KOG	Arylacetamide deacetylase	JGI		ISS
PTHR23024	Panther	MEMBER OF 'GDXG' FAMILY OF LIPOLYTIC ENZYMES	JGI		ISS
PTHR23024:SF10	Panther	CARBOXYLESTERASE-RELATED	JGI		ISS
PF07859	PFAM	alpha/beta hydrolase fold	JGI		ISS
UniRef100_I1JVZ1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JVZ1_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q9SSY8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Hsr203J homolog n=1 Tax=Pisum sativum RepID=Q9SSY8_PEA	SoyBase	E_val: 4.00E-135	ISS

Expression Patterns of Glyma04g15930

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g15930

Paralog	Evidence	Comments
Glyma06g46680	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g15930 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g128600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g15930

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g15930

Limit To All Plant Sequences

>Glyma04g15930.2   sequence type=CDS   gene model=Glyma04g15930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTCCAAGAAAAGAAACTAGTTGACGAGGTGTCCGGTTGGCTCAAAATCTATGACGACGGTTCAGTGGACCGGACATGGTCCAGACAGGACCAATTCAAGTTCATGGTCGAACGGGTCCCTCCCCACAAAAAATTCATAGACGGTGTCGCTGTCCGCAATGTTATCATTACTAACCACTGTGTCCGGCTTTATCCACCAGAGATAAAGTCGAAAGACAGCCAAAAACTACCAATTGTCCTCCATTTCCATGGGTGTGGGTTTTGCATAAGTGAACCTGACTGGTTCATGTACTACCAAATCCACACCCAGTTCGCCCAGTCCATCCGCTCCATAGTGGTTTCCCCGTTCCTCCGCCGTGCCCCTGAGCACCGCCTCCCTGCTGCCATCGACGACGGCTTTGACACCCTCATTTGGCTCCAAACAGTGGCCCAGTCTGGTTCATTTGAACCGTGGCTCGAGCAACACGGCGACTTCAACCGGGTTTTCCTTATAGGAGACAGTTCTGGCGGGAACTCGATGCATGAGGTGGCTGCGAGGGCCGCAATACCGGTTCACCACGGTTTTGTCCGGTCCGATCGGAGCCGGTCCGAGATGGAAATTCCGCAATCACCGTTTTTAATGTTGGACATGCTAGACAAGTTCTTAGCGTTGGCACTGCCGGTCGGGGCCACCAAGGACCACCCCTTCACGTGCCCGATGGGCATGGCAGCGCCACCGCTCAAAGGGCTGAAACTGTCGCCGTTGCTGCTGTGCGTGGCGGAGATGGACTTCGTGAGGGACACGGAGATGGAGTATTGTGAGTCCATGAAT

Predicted protein sequences of Glyma04g15930

Limit To All Plant Sequences

>Glyma04g15930.2   sequence type=predicted peptide   gene model=Glyma04g15930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVQEKKLVDEVSGWLKIYDDGSVDRTWSRQDQFKFMVERVPPHKKFIDGVAVRNVIITNHCVRLYPPEIKSKDSQKLPIVLHFHGCGFCISEPDWFMYYQIHTQFAQSIRSIVVSPFLRRAPEHRLPAAIDDGFDTLIWLQTVAQSGSFEPWLEQHGDFNRVFLIGDSSGGNSMHEVAARAAIPVHHGFVRSDRSRSEMEIPQSPFLMLDMLDKFLALALPVGATKDHPFTCPMGMAAPPLKGLKLSPLLLCVAEMDFVRDTEMEYCESMN

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain