Glyma04g15911 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g15911

Feature Type:	gene_model
Chromosome:	Gm04
Start:	16783544
stop:	16784774
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g15911

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
PF03760	PFAM	Late embryogenesis abundant (LEA) group 1	JGI		ISS
UniRef100_D7U5S7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=D7U5S7_VITVI	SoyBase	E_val: 4.00E-18	ISS
UniRef100_Q39138	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: LEA protein Le25 homolog n=1 Tax=Arabidopsis thaliana RepID=Q39138_ARATH	SoyBase	E_val: 2.00E-06	ISS

Expression Patterns of Glyma04g15911

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g15911 not represented in the dataset	Glyma04g15911 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g15911

Paralog	Evidence	Comments
Glyma06g46701	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g15911 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g128500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g15911

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma04g15911

Limit To All Plant Sequences

>Glyma04g15911.2   sequence type=transcript   gene model=Glyma04g15911   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GAAACTTTCATTTACTTTTGCCGGACATGTTTGAATTCAAGTGTTTCCTCCCAAATTTACATGTCTCCATTTGTGGACAATTTTGTACCTAATTGTCTAAGCCATATCTATCTTTATACCAATATATATGAATGAAGAGGCCGAGAAAGAGATTGCTAATGCCAGAAAGAATATAGCTCATGAGGTTAGGTTGGCAAAAGAAGCTGAAGCAACAATGGATATACACGTGGAAAAAGCAGGAAGAATAGCTGAGAAAGAAATATCAAAGCATGCATCTAAGAATCCAAACGTTGGTTATGAAAACATGAATTCCACAGATCCTGCTACAGTGGAAATAACAAATGGACCCGCCTCTACTATTAACTGAAAATCATGTTTATATTAGATTATTTAAAAGAAATGTTACATTTTATATAGCTTTAAATAAATATGAAACAAATATGTGTGGAAACACTCCACAAATGAAATATTTTGTAATATAAAAAAGAAAAATCTTGAAACTAATTAGTGTGATGTATAGGAACTTTTAGTTCAACTTTTCTTTCCATGTTATGATTTTTTTTTTCATTTATG

Coding sequences of Glyma04g15911

Limit To All Plant Sequences

>Glyma04g15911.1   sequence type=CDS   gene model=Glyma04g15911   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAAGCTGTGAAGGAAAAGCTACAAGATTTTAATGCTGCACGTAAGGCCAAGGCTGAAGCAAGGGCCGAAGAAAAGGCCGAGAAAGAGATTGCTAATGCCAGAAAGAATATAGCTCATGAGGTTAGGTTGGCAAAAGAAGCTGAAGCAACAATGGATATACACGTGGAAAAAGCAGGAAGAATAGCTGAGAAAGAAATATCAAAGCATGCATCTAAGAATCCAAACGTTGGTTATGAAAACATGAATTCCACAGATCCTGCTACAGTGGAAATAACAAATGGACCCGCCTCTACTATTAACTGA

>Glyma04g15911.2   sequence type=CDS   gene model=Glyma04g15911   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATGAAGAGGCCGAGAAAGAGATTGCTAATGCCAGAAAGAATATAGCTCATGAGGTTAGGTTGGCAAAAGAAGCTGAAGCAACAATGGATATACACGTGGAAAAAGCAGGAAGAATAGCTGAGAAAGAAATATCAAAGCATGCATCTAAGAATCCAAACGTTGGTTATGAAAACATGAATTCCACAGATCCTGCTACAGTGGAAATAACAAATGGACCCGCCTCTACTATTAACTGA

Predicted protein sequences of Glyma04g15911

Limit To All Plant Sequences

>Glyma04g15911.1   sequence type=predicted peptide   gene model=Glyma04g15911   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQAVKEKLQDFNAARKAKAEARAEEKAEKEIANARKNIAHEVRLAKEAEATMDIHVEKAGRIAEKEISKHASKNPNVGYENMNSTDPATVEITNGPASTIN*

>Glyma04g15911.2   sequence type=predicted peptide   gene model=Glyma04g15911   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNEEAEKEIANARKNIAHEVRLAKEAEATMDIHVEKAGRIAEKEISKHASKNPNVGYENMNSTDPATVEITNGPASTIN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain