SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g15840

Feature Type:gene_model
Chromosome:Gm04
Start:16672824
stop:16673732
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g15840
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G10360AT Annotation by Michelle Graham. TAIR10: Ribosomal protein S6e | chr5:3258734-3260142 REVERSE LENGTH=197 SoyBaseE_val: 3.00E-22ISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0040007GO-bp Annotation by Michelle Graham. GO Biological Process: growth SoyBaseN/AISS
GO:0042274GO-bp Annotation by Michelle Graham. GO Biological Process: ribosomal small subunit biogenesis SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0022627GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
PTHR11502Panther 40S RIBOSOMAL PROTEIN S6 JGI ISS
UniRef100_I3S397UniRef Annotation by Michelle Graham. Best UniRef hit: 40S ribosomal protein S6 n=1 Tax=Lotus japonicus RepID=I3S397_LOTJA SoyBaseE_val: 1.00E-21ISS
UniRef100_I3S397UniRef Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S6 n=1 Tax=Lotus japonicus RepID=I3S397_LOTJA SoyBaseE_val: 1.00E-21ISS

Expression Patterns of Glyma04g15840
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g15840 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g128200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g15840
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g15840
>Glyma04g15840.1   sequence type=CDS   gene model=Glyma04g15840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTGTGATGATTTCTAGTCTGAGTTACATATGTTTGGTTGTAGGGAAAAAGGTGAGCAAAGCTCCTAAGATACAACGGCTGGTCACTCCCCTGACCCTCCAAAGAAATAGGGCAAGGATTGCAGGTAAGAAGAAGAGAATTGCCAAAGCAAAATCAGAGGCAGCAGAGTACCAGAAACTTCTTGCCTCCAAAAAAATAAGCCTAGTTCAGCGTGTTACACGTTCGCTGGACTTGGCTCGATGCATAAAGCCCACTAAGCCCAGGAGTAGATTCAAATTGTCCAGTGCTTGA
Predicted protein sequences of Glyma04g15840
>Glyma04g15840.1   sequence type=predicted peptide   gene model=Glyma04g15840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIVMISSLSYICLVVGKKVSKAPKIQRLVTPLTLQRNRARIAGKKKRIAKAKSEAAEYQKLLASKKISLVQRVTRSLDLARCIKPTKPRSRFKLSSA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo