Glyma04g15831 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g15831

Feature Type:	gene_model
Chromosome:	Gm04
Start:	16669659
stop:	16671721
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g15831

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G13340	AT	Annotation by Michelle Graham. TAIR10: Transducin/WD40 repeat-like superfamily protein \| chr3:4332370-4334603 FORWARD LENGTH=447	SoyBase	E_val: 1.00E-13	ISS
GO:0000956	GO-bp	Annotation by Michelle Graham. GO Biological Process: nuclear-transcribed mRNA catabolic process	SoyBase	N/A	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005834	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: heterotrimeric G-protein complex	SoyBase	N/A	ISS
GO:0080008	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: CUL4-RING ubiquitin ligase complex	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_G7J0E2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: WD-repeat protein-like protein n=1 Tax=Medicago truncatula RepID=G7J0E2_MEDTR	SoyBase	E_val: 8.00E-12	ISS
UniRef100_I1JDU6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JDU6_SOYBN	SoyBase	E_val: 3.00E-15	ISS

Expression Patterns of Glyma04g15831

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g15831 not represented in the dataset	Glyma04g15831 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g15831 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma04g15831

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g15831

Limit To All Plant Sequences

>Glyma04g15831.1   sequence type=CDS   gene model=Glyma04g15831   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACAAGAGATATGCAGCAAATTTGTTGGAAGGATTTTCTCAGACCCAGATTAGCACATTAGCCGTCAAGGATAATCTTCTTGTTGCTGGTGGCTTCCAAGGAGAGCTTACTTGTAAGCATCAGCTCAGCGGTTTTGATTATTCGGCCTTATCGTTTTCTGATATATTTTATTTTTGGTCATGTCATGGTCATCAAGCTTCGTGGTTAGCAACGGGTACACGAAAAGAGAAAGAGAGGAACAAGGCCAAGTTTGGATGA

Predicted protein sequences of Glyma04g15831

Limit To All Plant Sequences

>Glyma04g15831.1   sequence type=predicted peptide   gene model=Glyma04g15831   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDKRYAANLLEGFSQTQISTLAVKDNLLVAGGFQGELTCKHQLSGFDYSALSFSDIFYFWSCHGHQASWLATGTRKEKERNKAKFG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain