SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma04g15560

Feature Type:gene_model
Chromosome:Gm04
Start:16338137
stop:16339045
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G10970AT Annotation by Michelle Graham. TAIR10: C2H2 and C2HC zinc fingers superfamily protein | chr5:3469268-3470086 FORWARD LENGTH=272 SoyBaseE_val: 3.00E-22ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR24882Panther FAMILY NOT NAMED JGI ISS
PTHR24882:SF162Panther JGI ISS
UniRef100_G7ZX08UniRef Annotation by Michelle Graham. Most informative UniRef hit: Zinc finger-like protein n=1 Tax=Medicago truncatula RepID=G7ZX08_MEDTR SoyBaseE_val: 1.00E-40ISS
UniRef100_I1JVY6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JVY6_SOYBN SoyBaseE_val: 3.00E-158ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g46860 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g127600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g15560.2   sequence type=CDS   gene model=Glyma04g15560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCATCATCACACGTTTTGGAAGGTTGTCCCTCCGAAGCCTCTAGCATCTCTGCCACCTCGGAAGGCATTTCTCATAAACCAAGTGCTGAAGAAGAGAATAATCATGATGAGGTGGCAAAAATGAAGGAGAAGGGTGTCAAATCTGAACAATATCAAGCTTCCAATTCCAATTCCCGCATGGTGTTGGATTTTGTTAAGCTCTCCCAAGATGAATCAATTCGAGGGTCGAAAGTGGAATTGGATTTTTTCAATCCAATGAACTTGGGGGGTTCACCTTCTTCTAGGGTTAAAAACACCGAAGGAAGAGATGAGAACAACAATGAAGAGAAATCATCAGAGGCTAAGACTTTTTCTTGCAATTTTTGCAAGAAAGAGTTTTCTTCATCACAAGCCTTGGGAGGGCACCAAAATGCTCACAAGCAAGAGCGTGCTCTCGCAAAGCGGCGCCAAGGGATTGATGTTGGTGCTTTTAGAAACCCTCATTTTCTTTATTACCCTTATCACCCCGCACACTCCTTTTATGGAACATATAATAGGGCACTTGGGGTTAGAATGGAGTCTATGATTCACAAGCCTTCATATCCTTCATCATCACTAGGTTTTAGGTTTGGTCAAGGGTGGTCAAGATCACAAGAGATGCTAAACCCTTCTCTTGATAGATTGAGGATTGAGGGTTTGCATGCAAATAGTGGAATTAGGATCCTAGGGAGTGACACTAGTTTGAGGACAAAAGATGATTGTGGTACTATTGGACACAACATTCCATTCCTTGGAGAATCTTCTACAAATGTTGCTACCAAATCAAACCCAGCCCCATTGAGTACCGTGGGTGGTGATCATCTCAAGCAAGAAGCATGCTCTAGTCCTGATTCTTCTGATGAGATTGATTTATCACTTAAGCTTTAG

>Glyma04g15560.2   sequence type=predicted peptide   gene model=Glyma04g15560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASSHVLEGCPSEASSISATSEGISHKPSAEEENNHDEVAKMKEKGVKSEQYQASNSNSRMVLDFVKLSQDESIRGSKVELDFFNPMNLGGSPSSRVKNTEGRDENNNEEKSSEAKTFSCNFCKKEFSSSQALGGHQNAHKQERALAKRRQGIDVGAFRNPHFLYYPYHPAHSFYGTYNRALGVRMESMIHKPSYPSSSLGFRFGQGWSRSQEMLNPSLDRLRIEGLHANSGIRILGSDTSLRTKDDCGTIGHNIPFLGESSTNVATKSNPAPLSTVGGDHLKQEACSSPDSSDEIDLSLKL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo