Glyma04g15283 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g15283): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g15283): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g15283

Feature Type:	gene_model
Chromosome:	Gm04
Start:	15920269
stop:	15922981
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g15283

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G52240	AT	Annotation by Michelle Graham. TAIR10: membrane steroid binding protein 1 \| chr5:21213121-21214619 FORWARD LENGTH=175	SoyBase	E_val: 3.00E-25	ISS
GO:0006888	GO-bp	Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport	SoyBase	N/A	ISS
GO:0030308	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of cell growth	SoyBase	N/A	ISS
GO:0048523	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of cellular process	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0005496	GO-mf	Annotation by Michelle Graham. GO Molecular Function: steroid binding	SoyBase	N/A	ISS
GO:0020037	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heme binding	SoyBase	N/A	ISS
PTHR10281	Panther	MEMBRANE ASSOCIATED PROGESTERONE RECEPTOR-RELATED	JGI		ISS
UniRef100_G5DXK7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Membrane steroid-binding protein (Fragment) n=1 Tax=Silene latifolia RepID=G5DXK7_SILLA	SoyBase	E_val: 5.00E-23	ISS
UniRef100_I1NGS1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NGS1_SOYBN	SoyBase	E_val: 1.00E-24	ISS

Expression Patterns of Glyma04g15283

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g15283 not represented in the dataset	Glyma04g15283 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g15283 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g126300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g15283

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g15283

Limit To All Plant Sequences

>Glyma04g15283.1   sequence type=CDS   gene model=Glyma04g15283   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGCCCTACCAGAATGTTTTATGGACCTGGTGGACCCTATGCTCTATTTGCTGGCAAGGATGCTAGCAGAGCTTTAGCAAAAATGTCTTTTGAAGAGAAAGATCTAACTGGAGATATCTCTGGTCTTGGACCGTTTCAAAATTATCTATTTGCCTTTCAAAAAAAATATAATAATTCGGGAGTCAACAAGTCAGAGATGGGTTTTGTTCTGAATCTTCTGATACATCTTCAGGGCTAG

Predicted protein sequences of Glyma04g15283

Limit To All Plant Sequences

>Glyma04g15283.1   sequence type=predicted peptide   gene model=Glyma04g15283   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCPTRMFYGPGGPYALFAGKDASRALAKMSFEEKDLTGDISGLGPFQNYLFAFQKKYNNSGVNKSEMGFVLNLLIHLQG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain