Glyma04g15260 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g15260): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g15260): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g15260

Feature Type:	gene_model
Chromosome:	Gm04
Start:	15918397
stop:	15918846
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g15260

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G03250	AT	Annotation by Michelle Graham. TAIR10: Homeodomain-like superfamily protein \| chr4:1425050-1427744 FORWARD LENGTH=507	SoyBase	E_val: 1.00E-50	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
KOG0484	KOG	Transcription factor PHOX2/ARIX, contains HOX domain	JGI		ISS
PTHR24326	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24326:SF77	Panther	HOMEOBOX TRANSCRIPTION FACTOR, PUTATIVE	JGI		ISS
PF00046	PFAM	Homeobox domain	JGI		ISS
UniRef100_F4JI72	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Homeobox-leucine zipper family protein n=2 Tax=Arabidopsis thaliana RepID=F4JI72_ARATH	SoyBase	E_val: 7.00E-48	ISS
UniRef100_I1M740	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M740_SOYBN	SoyBase	E_val: 1.00E-79	ISS

Expression Patterns of Glyma04g15260

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g15260 not represented in the dataset	Glyma04g15260 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g15260 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma04g15260

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g15260

Limit To All Plant Sequences

>Glyma04g15260.1   sequence type=CDS   gene model=Glyma04g15260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AATAAAGTCTCCAATGAGAAAAATAAGAAAAGAAAGCTGAAAACACCGGCCCAGCTTAAGGCCTTGGAGAATTTTTATAATGAGCACAAATACCCCACAGAGGAAATGAAATTAGTACTTGCTGAGGAGTTAGGATTGACAGAAAAGCAAATATCTGGATGGTTTTGCCACAGAAGGTTAAAAGATAAAAGATTGATGAAAGATGAAGCTGTTGCTAATGGGCGACAAGATCGTTCAAGTGGTGTCATCCAAGATCGTGGCAGTGGACTTGGGCAAGATTCATGCGGAAGCAGTAAGCATGCTGATCACAGGTATCTGGATCCTAAGGAGGTTGAGAGCCATGGCCTCTACAATCACGAA

Predicted protein sequences of Glyma04g15260

Limit To All Plant Sequences

>Glyma04g15260.1   sequence type=predicted peptide   gene model=Glyma04g15260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
NKVSNEKNKKRKLKTPAQLKALENFYNEHKYPTEEMKLVLAEELGLTEKQISGWFCHRRLKDKRLMKDEAVANGRQDRSSGVIQDRGSGLGQDSCGSSKHADHRYLDPKEVESHGLYNHE

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain