SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g15190): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g15190): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g15190

Feature Type:gene_model
Chromosome:Gm04
Start:15759653
stop:15760218
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G26140AT Annotation by Michelle Graham. TAIR10: beta-galactosidase 12 | chr4:13243219-13247823 REVERSE LENGTH=728 SoyBaseE_val: 9.00E-25ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0005990GO-bp Annotation by Michelle Graham. GO Biological Process: lactose catabolic process SoyBaseN/AISS
GO:0019513GO-bp Annotation by Michelle Graham. GO Biological Process: lactose catabolic process, using glucoside 3-dehydrogenase SoyBaseN/AISS
GO:0019515GO-bp Annotation by Michelle Graham. GO Biological Process: lactose catabolic process via UDP-galactose SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004553GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds SoyBaseN/AISS
GO:0004565GO-mf Annotation by Michelle Graham. GO Molecular Function: beta-galactosidase activity SoyBaseN/AISS
GO:0043169GO-mf Annotation by Michelle Graham. GO Molecular Function: cation binding SoyBaseN/AISS
PTHR23421Panther BETA-GALACTOSIDASE RELATED JGI ISS
PTHR23421:SF33Panther SUBFAMILY NOT NAMED JGI ISS
PF01301PFAM Glycosyl hydrolases family 35 JGI ISS
UniRef100_I1KUU7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Beta-galactosidase n=1 Tax=Glycine max RepID=I1KUU7_SOYBN SoyBaseE_val: 2.00E-25ISS
UniRef100_I1KUU7UniRef Annotation by Michelle Graham. Best UniRef hit: Beta-galactosidase n=1 Tax=Glycine max RepID=I1KUU7_SOYBN SoyBaseE_val: 2.00E-25ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g15190 not represented in the dataset

Glyma04g15190 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g15190.1   sequence type=CDS   gene model=Glyma04g15190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTTGTGTCCTATGACCATAAGCCTATCCTCATCAATGGACAGAGAAGGATAATGTGGCTAGATCTTATTCAAAAGGCAAAGGAAGGAGGTTTGGATGTCATTCAAACTTATGTTTTCTGGAATGAACATGAACCTTCACCTGGCAAAGTTACTCAAGCAGGCCTCTATGTTAACCTCAGAATTGGTCCTTAT

>Glyma04g15190.1   sequence type=predicted peptide   gene model=Glyma04g15190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
FVSYDHKPILINGQRRIMWLDLIQKAKEGGLDVIQTYVFWNEHEPSPGKVTQAGLYVNLRIGPY







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo