SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma04g15040

Feature Type:gene_model
Chromosome:Gm04
Start:15406598
stop:15408438
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G12360AT Annotation by Michelle Graham. TAIR10: Sec1/munc18-like (SM) proteins superfamily | chr1:4201172-4206144 FORWARD LENGTH=666 SoyBaseE_val: 5.00E-61ISS
GO:0000910GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis SoyBaseN/AISS
GO:0006623GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole SoyBaseN/AISS
GO:0006904GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle docking involved in exocytosis SoyBaseN/AISS
GO:0009306GO-bp Annotation by Michelle Graham. GO Biological Process: protein secretion SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0048193GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0019898GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extrinsic to membrane SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0008565GO-mf Annotation by Michelle Graham. GO Molecular Function: protein transporter activity SoyBaseN/AISS
PTHR11679Panther VESICLE PROTEIN SORTING-ASSOCIATED JGI ISS
PTHR11679:SF5Panther gb def: vacuolar sorting protein essential for vacuolar morphogenesis and function, vps3 JGI ISS
PF00995PFAM Sec1 family JGI ISS
UniRef100_G7JLB1UniRef Annotation by Michelle Graham. Most informative UniRef hit: SNARE-interacting protein KEULE n=1 Tax=Medicago truncatula RepID=G7JLB1_MEDTR SoyBaseE_val: 7.00E-77ISS
UniRef100_UPI000233A6ACUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A6AC related cluster n=1 Tax=unknown RepID=UPI000233A6AC SoyBaseE_val: 1.00E-84ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g15040.1   sequence type=CDS   gene model=Glyma04g15040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATCTCACCGACAAAAAAATTGCTATGTAGAGTTATGTTGTTGGTACTCAAAATTCATGAAACCTGCTTGCTGAGGTTCTTCCCCTTAGGGAACTTTATCAACCTTCAAATGTTCTCATTATGGTTTCTTTCTTTAGTGGAGCTATTTGGGGATAAGGAGAATAATAGTAAAGCTGTTGCATGTTTAAATGTGATGGCTACTCGGATTGCTATACTTTTTGCTTCATTAAGAGAATTTCCTTTTGTCCGCTTTCGTGTTGCCAAGTCCCTAGATGCAACCACAATGACTACCTTCCATGATCTTATTCCTGCAAAACTTGTTGCTAGTGTCTGGGACTGTCTTATGAAATATAAAAAAACTATACCTAATTTCCCTCAGACTAAAACCTGCGAGTTGCTCATCATTGATACAACTATTGATGAAATTGCTCCTGTGATACATGAATGGACATATGATGCCATGTGCCGTGATTTGTCAAATATGGAAGGAAATAAATATGTTCATGAGAAATCTACTGTATTCTTAATGTTCCTAGCAAGATCGATGGTCCACCTAAGCGAAAAGAGGTTCTCTTGGACGATCATGATCCTATATGGCTCATATGTTGAAAGTTCTATTTATGTATTACCCTTAAATACTAGAGTCAGTAGTAACACCTCCACTTACCACCCAAGGATACGAAACATTTGGATATTGATAGGTAGTGGTGAAATGTCGACAAGGGAGTTGCAAAAGATG

>Glyma04g15040.1   sequence type=predicted peptide   gene model=Glyma04g15040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ISPTKKLLCRVMLLVLKIHETCLLRFFPLGNFINLQMFSLWFLSLVELFGDKENNSKAVACLNVMATRIAILFASLREFPFVRFRVAKSLDATTMTTFHDLIPAKLVASVWDCLMKYKKTIPNFPQTKTCELLIIDTTIDEIAPVIHEWTYDAMCRDLSNMEGNKYVHEKSTVFLMFLARSMVHLSEKRFSWTIMILYGSYVESSIYVLPLNTRVSSNTSTYHPRIRNIWILIGSGEMSTRELQKM







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo