Report for Sequence Feature Glyma04g15040
Feature Type: gene_model
Chromosome: Gm04
Start: 15406598
stop: 15408438
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g15040
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G12360 AT
Annotation by Michelle Graham. TAIR10: Sec1/munc18-like (SM) proteins superfamily | chr1:4201172-4206144 FORWARD LENGTH=666
SoyBase E_val: 5.00E-61 ISS
GO:0000910 GO-bp
Annotation by Michelle Graham. GO Biological Process: cytokinesis
SoyBase N/A ISS
GO:0006623 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole
SoyBase N/A ISS
GO:0006904 GO-bp
Annotation by Michelle Graham. GO Biological Process: vesicle docking involved in exocytosis
SoyBase N/A ISS
GO:0009306 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein secretion
SoyBase N/A ISS
GO:0010200 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to chitin
SoyBase N/A ISS
GO:0016192 GO-bp
Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport
SoyBase N/A ISS
GO:0030968 GO-bp
Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response
SoyBase N/A ISS
GO:0048193 GO-bp
Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport
SoyBase N/A ISS
GO:0005773 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: vacuole
SoyBase N/A ISS
GO:0005829 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosol
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0019898 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extrinsic to membrane
SoyBase N/A ISS
GO:0005515 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein binding
SoyBase N/A ISS
GO:0008565 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein transporter activity
SoyBase N/A ISS
PTHR11679 Panther
VESICLE PROTEIN SORTING-ASSOCIATED
JGI ISS
PTHR11679:SF5 Panther
gb def: vacuolar sorting protein essential for vacuolar morphogenesis and function, vps3
JGI ISS
PF00995 PFAM
Sec1 family
JGI ISS
UniRef100_G7JLB1 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: SNARE-interacting protein KEULE n=1 Tax=Medicago truncatula RepID=G7JLB1_MEDTR
SoyBase E_val: 7.00E-77 ISS
UniRef100_UPI000233A6AC UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233A6AC related cluster n=1 Tax=unknown RepID=UPI000233A6AC
SoyBase E_val: 1.00E-84 ISS
Expression Patterns of Glyma04g15040
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma04g15040 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma04g15040
Coding sequences of Glyma04g15040
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g15040.1 sequence type=CDS gene model=Glyma04g15040 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATCTCACCGACAAAAAAATTGCTATGTAGAGTTATGTTGTTGGTACTCAAAATTCATGAAACCTGCTTGCTGAGGTTCTTCCCCTTAGGGAACTTTATCAACCTTCAAATGTTCTCATTATGGTTTCTTTCTTTAGTGGAGCTATTTGGGGATAAGGAGAATAATAGTAAAGCTGTTGCATGTTTAAATGTGATGGCTACTCGGATTGCTATACTTTTTGCTTCATTAAGAGAATTTCCTTTTGTCCGCTTTCGTGTTGCCAAGTCCCTAGATGCAACCACAATGACTACCTTCCATGATCTTATTCCTGCAAAACTTGTTGCTAGTGTCTGGGACTGTCTTATGAAATATAAAAAAACTATACCTAATTTCCCTCAGACTAAAACCTGCGAGTTGCTCATCATTGATACAACTATTGATGAAATTGCTCCTGTGATACATGAATGGACATATGATGCCATGTGCCGTGATTTGTCAAATATGGAAGGAAATAAATATGTTCATGAGAAATCTACTGTATTCTTAATGTTCCTAGCAAGATCGATGGTCCACCTAAGCGAAAAGAGGTTCTCTTGGACGATCATGATCCTATATGGCTCATATGTTGAAAGTTCTATTTATGTATTACCCTTAAATACTAGAGTCAGTAGTAACACCTCCACTTACCACCCAAGGATACGAAACATTTGGATATTGATAGGTAGTGGTGAAATGTCGACAAGGGAGTTGCAAAAGATG
Predicted protein sequences of Glyma04g15040
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g15040.1 sequence type=predicted peptide gene model=Glyma04g15040 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ISPTKKLLCRVMLLVLKIHETCLLRFFPLGNFINLQMFSLWFLSLVELFGDKENNSKAVACLNVMATRIAILFASLREFPFVRFRVAKSLDATTMTTFHDLIPAKLVASVWDCLMKYKKTIPNFPQTKTCELLIIDTTIDEIAPVIHEWTYDAMCRDLSNMEGNKYVHEKSTVFLMFLARSMVHLSEKRFSWTIMILYGSYVESSIYVLPLNTRVSSNTSTYHPRIRNIWILIGSGEMSTRELQKM