Glyma04g15040 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g15040): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g15040): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g15040

Feature Type:	gene_model
Chromosome:	Gm04
Start:	15406598
stop:	15408438
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g15040

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G12360	AT	Annotation by Michelle Graham. TAIR10: Sec1/munc18-like (SM) proteins superfamily \| chr1:4201172-4206144 FORWARD LENGTH=666	SoyBase	E_val: 5.00E-61	ISS
GO:0000910	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytokinesis	SoyBase	N/A	ISS
GO:0006623	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole	SoyBase	N/A	ISS
GO:0006904	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle docking involved in exocytosis	SoyBase	N/A	ISS
GO:0009306	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein secretion	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0030968	GO-bp	Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response	SoyBase	N/A	ISS
GO:0048193	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0019898	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extrinsic to membrane	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0008565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein transporter activity	SoyBase	N/A	ISS
PTHR11679	Panther	VESICLE PROTEIN SORTING-ASSOCIATED	JGI		ISS
PTHR11679:SF5	Panther	gb def: vacuolar sorting protein essential for vacuolar morphogenesis and function, vps3	JGI		ISS
PF00995	PFAM	Sec1 family	JGI		ISS
UniRef100_G7JLB1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: SNARE-interacting protein KEULE n=1 Tax=Medicago truncatula RepID=G7JLB1_MEDTR	SoyBase	E_val: 7.00E-77	ISS
UniRef100_UPI000233A6AC	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233A6AC related cluster n=1 Tax=unknown RepID=UPI000233A6AC	SoyBase	E_val: 1.00E-84	ISS

Expression Patterns of Glyma04g15040

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g15040 not represented in the dataset	Glyma04g15040 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g15040 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma04g15040

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g15040

Limit To All Plant Sequences

>Glyma04g15040.1   sequence type=CDS   gene model=Glyma04g15040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATCTCACCGACAAAAAAATTGCTATGTAGAGTTATGTTGTTGGTACTCAAAATTCATGAAACCTGCTTGCTGAGGTTCTTCCCCTTAGGGAACTTTATCAACCTTCAAATGTTCTCATTATGGTTTCTTTCTTTAGTGGAGCTATTTGGGGATAAGGAGAATAATAGTAAAGCTGTTGCATGTTTAAATGTGATGGCTACTCGGATTGCTATACTTTTTGCTTCATTAAGAGAATTTCCTTTTGTCCGCTTTCGTGTTGCCAAGTCCCTAGATGCAACCACAATGACTACCTTCCATGATCTTATTCCTGCAAAACTTGTTGCTAGTGTCTGGGACTGTCTTATGAAATATAAAAAAACTATACCTAATTTCCCTCAGACTAAAACCTGCGAGTTGCTCATCATTGATACAACTATTGATGAAATTGCTCCTGTGATACATGAATGGACATATGATGCCATGTGCCGTGATTTGTCAAATATGGAAGGAAATAAATATGTTCATGAGAAATCTACTGTATTCTTAATGTTCCTAGCAAGATCGATGGTCCACCTAAGCGAAAAGAGGTTCTCTTGGACGATCATGATCCTATATGGCTCATATGTTGAAAGTTCTATTTATGTATTACCCTTAAATACTAGAGTCAGTAGTAACACCTCCACTTACCACCCAAGGATACGAAACATTTGGATATTGATAGGTAGTGGTGAAATGTCGACAAGGGAGTTGCAAAAGATG

Predicted protein sequences of Glyma04g15040

Limit To All Plant Sequences

>Glyma04g15040.1   sequence type=predicted peptide   gene model=Glyma04g15040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ISPTKKLLCRVMLLVLKIHETCLLRFFPLGNFINLQMFSLWFLSLVELFGDKENNSKAVACLNVMATRIAILFASLREFPFVRFRVAKSLDATTMTTFHDLIPAKLVASVWDCLMKYKKTIPNFPQTKTCELLIIDTTIDEIAPVIHEWTYDAMCRDLSNMEGNKYVHEKSTVFLMFLARSMVHLSEKRFSWTIMILYGSYVESSIYVLPLNTRVSSNTSTYHPRIRNIWILIGSGEMSTRELQKM

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain