Glyma04g14710 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g14710

Feature Type:	gene_model
Chromosome:	Gm04
Start:	14910966
stop:	14914504
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g14710

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G11760	AT	Annotation by Michelle Graham. TAIR10: MED32; Has 41 Blast hits to 40 proteins in 14 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 41; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). \| chr1:3972356-3972811 REVERSE LENGTH=151	SoyBase	E_val: 5.00E-65	ISS
GO:0016592	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mediator complex	SoyBase	N/A	ISS
PTHR21528	Panther	UNCHARACTERIZED	JGI		ISS
UniRef100_I1JVU8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JVU8_SOYBN	SoyBase	E_val: 5.00E-103	ISS
UniRef100_Q84VW5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Mediator of RNA polymerase II transcription subunit 32 n=1 Tax=Arabidopsis thaliana RepID=MED32_ARATH	SoyBase	E_val: 2.00E-62	ISS

Expression Patterns of Glyma04g14710

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g14710

Paralog	Evidence	Comments
Glyma09g34810	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g14710 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g123300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g14710

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g14710

Limit To All Plant Sequences

>Glyma04g14710.5   sequence type=CDS   gene model=Glyma04g14710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACAGCATAGTTGATTCTCTGAATAATGCCTATCAAGATTTTGTTGCTGCAGCAGCTAATGTGTTAGAAGCCAAAGAAAATGCTGGTTCCATTAAAACAATGGCAACAGATACTGCTCTAGAAAACTTTAAGCAGAAGTGGGAATTGTTTAGAGTAGCATGTGATCAAGCTGAGGAGTTTGTGGAGTCTGTGAAGCAAAGGATAGGATCTGAGTGTCTGGTGGATGAGGCAACAAGGCCTGTGGCAGGAAAACCTGGACAAGCTACCATGACCGGTCTTCCTCCCATTAGTGCAGTTCGGTTGGAACAGATGAGTAAAGCTGTTCGATGGCTTGTGATTGAATTGCAGCATGGCTCTGGAGCTGGTTCTGCTAATTCAGCTCTTACCCACCCCTCAGCTCCGTTTGATGCCAGGTTTTCTGAAGATGCTGCTCAGTAG

Predicted protein sequences of Glyma04g14710

Limit To All Plant Sequences

>Glyma04g14710.5   sequence type=predicted peptide   gene model=Glyma04g14710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDSIVDSLNNAYQDFVAAAANVLEAKENAGSIKTMATDTALENFKQKWELFRVACDQAEEFVESVKQRIGSECLVDEATRPVAGKPGQATMTGLPPISAVRLEQMSKAVRWLVIELQHGSGAGSANSALTHPSAPFDARFSEDAAQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain