SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g14460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g14460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g14460

Feature Type:gene_model
Chromosome:Gm04
Start:14545239
stop:14546622
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g14460
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G11710AT Annotation by Michelle Graham. TAIR10: ENTH/VHS family protein | chr5:3772981-3776316 FORWARD LENGTH=560 SoyBaseE_val: 5.00E-42ISS
GO:0006623GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole SoyBaseN/AISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005884GO-cc Annotation by Michelle Graham. GO Cellular Compartment: actin filament SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0002020GO-mf Annotation by Michelle Graham. GO Molecular Function: protease binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0030276GO-mf Annotation by Michelle Graham. GO Molecular Function: clathrin binding SoyBaseN/AISS
PTHR12276Panther EPSIN/ENT-RELATED JGI ISS
PTHR12276:SF7Panther EPSIN 2 JGI ISS
PF01417PFAM ENTH domain JGI ISS
UniRef100_I1MXE8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MXE8_SOYBN SoyBaseE_val: 2.00E-46ISS
UniRef100_Q8VY07UniRef Annotation by Michelle Graham. Most informative UniRef hit: Clathrin interactor EPSIN 1 n=1 Tax=Arabidopsis thaliana RepID=EPN1_ARATH SoyBaseE_val: 3.00E-39ISS

Expression Patterns of Glyma04g14460
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g14460 not represented in the dataset
Glyma04g14460 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g14460 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma04g14460
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g14460
>Glyma04g14460.1   sequence type=CDS   gene model=Glyma04g14460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAGAGAGAGGTGAATCTGAAGGTGCTCAAGGTTTCGGAAATCGAATCGAAGGTGCTGGATGCTACTGATAATGAACCTTGGGGTCCTCATGGTACTGTGCTGGCAGAGATTTCAAAGGCTACCAAAAAATTTACTGAATGTCAAATGGTCATGAATGTCCTTTGGACAAGACTGGGTGAAACTGGAAAAGATTGGCGTTATGTATACAAGTCAAGCATTAGCTGTCATAGAATATTTGAACATACTTTTCAGATCTCTAATAAGAGAGTATTTTCTCATAATTTACTCTGGATTGATAAGATACATGAAGTCAGAAATAAAGCTGCAAACTGTACGTTGGAGTTTCTTTTTTTAGTTAATACTCTCAAGCAATGTTTTTGGGCATCAAATTACCAAGAGCCAAAAATCTTTTCTCTCCCTTAG
Predicted protein sequences of Glyma04g14460
>Glyma04g14460.1   sequence type=predicted peptide   gene model=Glyma04g14460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KREVNLKVLKVSEIESKVLDATDNEPWGPHGTVLAEISKATKKFTECQMVMNVLWTRLGETGKDWRYVYKSSISCHRIFEHTFQISNKRVFSHNLLWIDKIHEVRNKAANCTLEFLFLVNTLKQCFWASNYQEPKIFSLP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo