Glyma04g14430 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g14430): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g14430): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g14430

Feature Type:	gene_model
Chromosome:	Gm04
Start:	14527113
stop:	14527597
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g14430

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G04770	AT	Annotation by Michelle Graham. TAIR10: 40s ribosomal protein SA B \| chr3:1309465-1310846 REVERSE LENGTH=332	SoyBase	E_val: 4.00E-20	ISS
GO:0000028	GO-bp	Annotation by Michelle Graham. GO Biological Process: ribosomal small subunit assembly	SoyBase	N/A	ISS
GO:0000447	GO-bp	Annotation by Michelle Graham. GO Biological Process: endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	SoyBase	N/A	ISS
GO:0000461	GO-bp	Annotation by Michelle Graham. GO Biological Process: endonucleolytic cleavage to generate mature 3'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	SoyBase	N/A	ISS
GO:0006407	GO-bp	Annotation by Michelle Graham. GO Biological Process: rRNA export from nucleus	SoyBase	N/A	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0006606	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein import into nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0022626	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome	SoyBase	N/A	ISS
GO:0022627	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit	SoyBase	N/A	ISS
GO:0030686	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: 90S preribosome	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
PTHR11489	Panther	RIBOSOMAL PROTEIN S2, EUKARYOTIC AND ARCHAEAL FORM	JGI		ISS
PTHR11489:SF7	Panther	40S RIBOSOMAL PROTEIN SA	JGI		ISS
UniRef100_O65751	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein SA n=1 Tax=Cicer arietinum RepID=RSSA_CICAR	SoyBase	E_val: 4.00E-22	ISS
UniRef100_UPI000189D1B4	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000189D1B4 related cluster n=1 Tax=unknown RepID=UPI000189D1B4	SoyBase	E_val: 3.00E-22	ISS

Expression Patterns of Glyma04g14430

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g14430 not represented in the dataset	Glyma04g14430 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g14430 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma04g14430

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g14430

Limit To All Plant Sequences

>Glyma04g14430.1   sequence type=CDS   gene model=Glyma04g14430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GCTACGAATGCCACTGTCGCCCCACCACGCCAGCTCTCCCAGAAGGAAGTCGACATCCAGATGATGTTGGCCGTCGATGTCCACCTCGACACCAAGAACTGCAACTTCCAAATGGAACATTACATCTTCAAGCGCCACAACGACGTTGATATCATTGTGCAATCTTACACTGGTGCTCATGCTATTGTTGGAAGGCACACTCCC

Predicted protein sequences of Glyma04g14430

Limit To All Plant Sequences

>Glyma04g14430.1   sequence type=predicted peptide   gene model=Glyma04g14430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATNATVAPPRQLSQKEVDIQMMLAVDVHLDTKNCNFQMEHYIFKRHNDVDIIVQSYTGAHAIVGRHTP

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain