Report for Sequence Feature Glyma04g14430
Feature Type: gene_model
Chromosome: Gm04
Start: 14527113
stop: 14527597
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g14430
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G04770 AT
Annotation by Michelle Graham. TAIR10: 40s ribosomal protein SA B | chr3:1309465-1310846 REVERSE LENGTH=332
SoyBase E_val: 4.00E-20 ISS
GO:0000028 GO-bp
Annotation by Michelle Graham. GO Biological Process: ribosomal small subunit assembly
SoyBase N/A ISS
GO:0000447 GO-bp
Annotation by Michelle Graham. GO Biological Process: endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
SoyBase N/A ISS
GO:0000461 GO-bp
Annotation by Michelle Graham. GO Biological Process: endonucleolytic cleavage to generate mature 3'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
SoyBase N/A ISS
GO:0006407 GO-bp
Annotation by Michelle Graham. GO Biological Process: rRNA export from nucleus
SoyBase N/A ISS
GO:0006412 GO-bp
Annotation by Michelle Graham. GO Biological Process: translation
SoyBase N/A ISS
GO:0006606 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein import into nucleus
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0016020 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: membrane
SoyBase N/A ISS
GO:0022626 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome
SoyBase N/A ISS
GO:0022627 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit
SoyBase N/A ISS
GO:0030686 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: 90S preribosome
SoyBase N/A ISS
GO:0003735 GO-mf
Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome
SoyBase N/A ISS
PTHR11489 Panther
RIBOSOMAL PROTEIN S2, EUKARYOTIC AND ARCHAEAL FORM
JGI ISS
PTHR11489:SF7 Panther
40S RIBOSOMAL PROTEIN SA
JGI ISS
UniRef100_O65751 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein SA n=1 Tax=Cicer arietinum RepID=RSSA_CICAR
SoyBase E_val: 4.00E-22 ISS
UniRef100_UPI000189D1B4 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000189D1B4 related cluster n=1 Tax=unknown RepID=UPI000189D1B4
SoyBase E_val: 3.00E-22 ISS
Expression Patterns of Glyma04g14430
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma04g14430 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma04g14430
Coding sequences of Glyma04g14430
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g14430.1 sequence type=CDS gene model=Glyma04g14430 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
GCTACGAATGCCACTGTCGCCCCACCACGCCAGCTCTCCCAGAAGGAAGTCGACATCCAGATGATGTTGGCCGTCGATGTCCACCTCGACACCAAGAACTGCAACTTCCAAATGGAACATTACATCTTCAAGCGCCACAACGACGTTGATATCATTGTGCAATCTTACACTGGTGCTCATGCTATTGTTGGAAGGCACACTCCC
Predicted protein sequences of Glyma04g14430
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g14430.1 sequence type=predicted peptide gene model=Glyma04g14430 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATNATVAPPRQLSQKEVDIQMMLAVDVHLDTKNCNFQMEHYIFKRHNDVDIIVQSYTGAHAIVGRHTP