|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G68310 | AT | Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF59) | chr1:25599812-25601239 FORWARD LENGTH=157 | SoyBase | E_val: 4.00E-39 | ISS |
GO:0009944 | GO-bp | Annotation by Michelle Graham. GO Biological Process: polarity specification of adaxial/abaxial axis | SoyBase | N/A | ISS |
GO:0042127 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of cell proliferation | SoyBase | N/A | ISS |
GO:0051726 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle | SoyBase | N/A | ISS |
GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
GO:0010209 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: vacuolar sorting signal binding | SoyBase | N/A | ISS |
KOG3381 | KOG | Uncharacterized conserved protein | JGI | ISS | |
PTHR12377 | Panther | UNCHARACTERIZED | JGI | ISS | |
PF01883 | PFAM | Domain of unknown function DUF59 | JGI | ISS | |
UniRef100_G7K9K6 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Protein FAM96B n=1 Tax=Medicago truncatula RepID=G7K9K6_MEDTR | SoyBase | E_val: 1.00E-48 | ISS |
UniRef100_UPI000233A54A | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233A54A related cluster n=1 Tax=unknown RepID=UPI000233A54A | SoyBase | E_val: 2.00E-69 | ISS |
Glyma04g14341 not represented in the dataset |
Glyma04g14341 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.04g121600 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma04g14341.1 sequence type=CDS gene model=Glyma04g14341 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGTAACTGAGTTAATCAATGTGAACCCTATCATATATGAAAAGAAAGAGCGTCGAGCTCCATCTACTCCCCATGATGAGTATGATGTCGAACCAATCGACCAACAAGAGGACCCTGAGCATCCATATTCCTTGGAAGAGCTTAAGGTGATTACCGAGGAAGCAGTTGAACTTGATGATCAGCATAATATGGTTACATTTACTCCAACAGTGGAACATTGCAGTATGGCAACAGTTATAGGTCTATGCTTACTTAACAAACAATTAAATGATAAAGAACGGGTGGCTGCTGCACTAGAAAACCTAAACCTTTTGAATATGGTTGATGATTGTCTTGCTCCATCTTATGATTAA
>Glyma04g14341.1 sequence type=predicted peptide gene model=Glyma04g14341 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MVTELINVNPIIYEKKERRAPSTPHDEYDVEPIDQQEDPEHPYSLEELKVITEEAVELDDQHNMVTFTPTVEHCSMATVIGLCLLNKQLNDKERVAAALENLNLLNMVDDCLAPSYD*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||