|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G36360 | AT | Annotation by Michelle Graham. TAIR10: beta-galactosidase 3 | chr4:17176840-17181143 REVERSE LENGTH=855 | SoyBase | E_val: 9.00E-43 | ISS |
| GO:0005975 | GO-bp | Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process | SoyBase | N/A | ISS |
| GO:0005990 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lactose catabolic process | SoyBase | N/A | ISS |
| GO:0006598 | GO-bp | Annotation by Michelle Graham. GO Biological Process: polyamine catabolic process | SoyBase | N/A | ISS |
| GO:0009664 | GO-bp | Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization | SoyBase | N/A | ISS |
| GO:0009698 | GO-bp | Annotation by Michelle Graham. GO Biological Process: phenylpropanoid metabolic process | SoyBase | N/A | ISS |
| GO:0009832 | GO-bp | Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis | SoyBase | N/A | ISS |
| GO:0010075 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth | SoyBase | N/A | ISS |
| GO:0019513 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lactose catabolic process, using glucoside 3-dehydrogenase | SoyBase | N/A | ISS |
| GO:0019515 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lactose catabolic process via UDP-galactose | SoyBase | N/A | ISS |
| GO:0042398 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular modified amino acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
| GO:0003824 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: catalytic activity | SoyBase | N/A | ISS |
| GO:0004553 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds | SoyBase | N/A | ISS |
| GO:0004565 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: beta-galactosidase activity | SoyBase | N/A | ISS |
| GO:0030246 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: carbohydrate binding | SoyBase | N/A | ISS |
| GO:0043169 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: cation binding | SoyBase | N/A | ISS |
| PTHR23421 | Panther | BETA-GALACTOSIDASE RELATED | JGI | ISS | |
| PTHR23421:SF2 | Panther | BETA-GALACTOSIDASE | JGI | ISS | |
| PF01301 | PFAM | Glycosyl hydrolases family 35 | JGI | ISS | |
| UniRef100_I1JCK7 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Beta-galactosidase n=1 Tax=Glycine max RepID=I1JCK7_SOYBN | SoyBase | E_val: 2.00E-44 | ISS |
| UniRef100_I1JCK7 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Beta-galactosidase n=1 Tax=Glycine max RepID=I1JCK7_SOYBN | SoyBase | E_val: 2.00E-44 | ISS |
|
Glyma04g14301 not represented in the dataset |
Glyma04g14301 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.04g121400 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma04g14301.1 sequence type=CDS gene model=Glyma04g14301 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGTTGTTGAAATGGAAACTGGGGTCCCTTGGGTGATGTGCAAGGAAGATGATGCACCAGATCTAATGATAAACACCTGCAATGGCTTCTATTGTCATAAATTTACTCCAAATAGACCCTATAAGCCTATGATTTGGACAAAGGCTTGGAGTGGCTGGTTTACAGAATTTGGAGGTCCAATTCACAAAAGACCTGTCCAGGATTTGGCATTTACAACTGCTAGATTTATAAAACATGCCATGCAAATAAGGAAACGGATCTATGATTGA
>Glyma04g14301.1 sequence type=predicted peptide gene model=Glyma04g14301 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MVVEMETGVPWVMCKEDDAPDLMINTCNGFYCHKFTPNRPYKPMIWTKAWSGWFTEFGGPIHKRPVQDLAFTTARFIKHAMQIRKRIYD*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||