Glyma04g14250 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g14250

Feature Type:	gene_model
Chromosome:	Gm04
Start:	14132491
stop:	14136551
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g14250

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G29330	AT	Annotation by Michelle Graham. TAIR10: DERLIN-1 \| chr4:14444937-14446952 FORWARD LENGTH=266	SoyBase	E_val: 4.00E-99	ISS
GO:0006457	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein folding	SoyBase	N/A	ISS
GO:0006508	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis	SoyBase	N/A	ISS
GO:0009408	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to heat	SoyBase	N/A	ISS
GO:0009644	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to high light intensity	SoyBase	N/A	ISS
GO:0034976	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress	SoyBase	N/A	ISS
GO:0042542	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG0858	KOG	Predicted membrane protein	JGI		ISS
PTHR11009	Panther	DER1-LIKE PROTEIN, DERLIN	JGI		ISS
PF04511	PFAM	Der1-like family	JGI		ISS
UniRef100_B9T8V1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Derlin-2, putative n=1 Tax=Ricinus communis RepID=B9T8V1_RICCO	SoyBase	E_val: 6.00E-153	ISS
UniRef100_I1JVS9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JVS9_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma04g14250

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g14250 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g121000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g14250

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g14250

Limit To All Plant Sequences

>Glyma04g14250.1   sequence type=CDS   gene model=Glyma04g14250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTACACCAGCAGAATACTACCGGTCTCTACCACCTGTGAGCAAGGCCTATGGAGTGGCCTGTTTAATGACTACTGCTGCATTTTATCTGCAATTCTATGATGCATGGAACATAGCACTTGATTATGGCTCAGTGTTTAAACGCCTTCAAGTTTGGAGGCTTATCACAAATTTCTTCTTTCTTGGCCCGTTTTCATTTCCATTTGCAATCCGTCTGATAATAATAGCAAAATATGGTGTTTCATTGGAAAGAGGGCCCTTTGACAATAGAACTGCGGATTATGTTTGGATGTTCATTTTTGGTGCACTCTCACTTCTGGTGATTGCAGCTGTGCCATTTTTTTGGTATCCATTCATGGGAATTTCCTTAGTTTTCATGCTCGTCTATGTTTGGAGCCGCGAGTTTCCAAATGCACGAATCAACATTTATGGTGTTGTATCATTGAAGGGTTTTTACCTTCCATGGGCTTTGCTAGCTCTGGATTTAATATTTGGAGATCCTATAAAGCCAGACATTGTAGGTATGATTGCAGGACATCTATACTACTTCTTAACAGTGCTTCACCCTCTCGCAGGAGGAAAGTTCAGATTCAAGACTCCTCTGTGGGTTCACAAAATAGTGGCATATTGGGGAGAGGGTACTCAAATAAATGCCCCTGTGCAATCTAATCCATCAGCTGGAATTGTATTCAAAGGAAGAAGCCACCGTCTTGGTGGGACTCAGACAACAACAAGAAGAACTGCAGAGCAAACTGAAGGGAATGATTCTGCTTCCTGCCCTCAACCGCAGAATCAGGGTGATGGAATTGCTTTCCGTGGAAAAAGTTATCGTTTGGATGGATGA

Predicted protein sequences of Glyma04g14250

Limit To All Plant Sequences

>Glyma04g14250.1   sequence type=predicted peptide   gene model=Glyma04g14250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSTPAEYYRSLPPVSKAYGVACLMTTAAFYLQFYDAWNIALDYGSVFKRLQVWRLITNFFFLGPFSFPFAIRLIIIAKYGVSLERGPFDNRTADYVWMFIFGALSLLVIAAVPFFWYPFMGISLVFMLVYVWSREFPNARINIYGVVSLKGFYLPWALLALDLIFGDPIKPDIVGMIAGHLYYFLTVLHPLAGGKFRFKTPLWVHKIVAYWGEGTQINAPVQSNPSAGIVFKGRSHRLGGTQTTTRRTAEQTEGNDSASCPQPQNQGDGIAFRGKSYRLDG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain