SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g13531

Feature Type:gene_model
Chromosome:Gm04
Start:13183276
stop:13183908
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g13531
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G54500AT Annotation by Michelle Graham. TAIR10: flavodoxin-like quinone reductase 1 | chr5:22124674-22126256 FORWARD LENGTH=204 SoyBaseE_val: 2.00E-64ISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0045892GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0010181GO-mf Annotation by Michelle Graham. GO Molecular Function: FMN binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016655GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor SoyBaseN/AISS
PF03358PFAM NADPH-dependent FMN reductase JGI ISS
UniRef100_B9RXX3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Flavoprotein wrbA, putative n=1 Tax=Ricinus communis RepID=B9RXX3_RICCO SoyBaseE_val: 3.00E-67ISS
UniRef100_UPI000233A539UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A539 related cluster n=1 Tax=unknown RepID=UPI000233A539 SoyBaseE_val: 4.00E-82ISS

Expression Patterns of Glyma04g13531
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g13531 not represented in the dataset
Glyma04g13531 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g13531 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma04g13531
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g13531
>Glyma04g13531.1   sequence type=CDS   gene model=Glyma04g13531   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTACGAACATGTTGAGAAGCTAGCTGACGAGATTAAAAAAGGAGTTGTTTTTGTTGAAGGAGTAGAAGCAAAGCTATGGTACCTGAAACAATCTGGGTATTTTCATTATGTATTTATGATGTTCTTATTCATACAGGTCCTTGGGAAAATGGGAGCACCTCCAAAGACTGATGTACCAATTATGACACCCAATGAGCTACCTAAGGCTGATGGCTTATTGCTTGGTTTCCCCACAAGATTTGGACTAATGGCTGCTCAATTCAAAGTTTTCATGGATGCAACTGGAGGTCTATGGTGCACACAGACACTAGCTGGAAAGTCTGCAGGAATCTTTTACAGCATTGGCTCTGAAGGAGGTGGACAACAGACCACTCCGTTGACATCTATTACTCAGCTTGTTCACCATGGGATGATTTTTGTGCCCATTGGTTACTCA
Predicted protein sequences of Glyma04g13531
>Glyma04g13531.1   sequence type=predicted peptide   gene model=Glyma04g13531   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYEHVEKLADEIKKGVVFVEGVEAKLWYLKQSGYFHYVFMMFLFIQVLGKMGAPPKTDVPIMTPNELPKADGLLLGFPTRFGLMAAQFKVFMDATGGLWCTQTLAGKSAGIFYSIGSEGGGQQTTPLTSITQLVHHGMIFVPIGYS






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo