SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma04g12890

Feature Type:gene_model
Chromosome:Gm04
Start:12284190
stop:12294921
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G56280AT Annotation by Michelle Graham. TAIR10: COP9 signalosome subunit 6A | chr5:22783617-22785530 REVERSE LENGTH=317 SoyBaseE_val: 0ISS
GO:0000085GO-bp Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle SoyBaseN/AISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0007275GO-bp Annotation by Michelle Graham. GO Biological Process: multicellular organismal development SoyBaseN/AISS
GO:0009165GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide biosynthetic process SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0010387GO-bp Annotation by Michelle Graham. GO Biological Process: signalosome assembly SoyBaseN/AISS
GO:0030163GO-bp Annotation by Michelle Graham. GO Biological Process: protein catabolic process SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0043248GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome assembly SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0008180GO-cc Annotation by Michelle Graham. GO Cellular Compartment: signalosome SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG3050 KOG COP9 signalosome, subunit CSN6 JGI ISS
PTHR10540Panther EIF3F-RELATED JGI ISS
PF01398PFAM Mov34/MPN/PAD-1 family JGI ISS
UniRef100_B9ST91UniRef Annotation by Michelle Graham. Most informative UniRef hit: Signalosome subunit, putative n=1 Tax=Ricinus communis RepID=B9ST91_RICCO SoyBaseE_val: 0ISS
UniRef100_I1JVP4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JVP4_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g47850 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g115900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g12890.1   sequence type=CDS   gene model=Glyma04g12890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCTTCATCGAGTAGCGGATTGACGTTCAAGCTGCACCCTCTGGTGATCGTAAACATCTCGGACCACTACACCAGGGTCAAGTCTCAGATGAACCCAACCCACGCGCCACCGCACAACAACAACAACGCCAACGGCGGCGACGGCGTCGTTTCGCCGCTCTCCCCGCGGGTCTATGGCTGCGTCATAGGGGTCCAGAAGGGCCGCACCGTGGAGATCTTCAACAGCTTCGAACTCCTCTACGATCCTTCCTCCCACTCCCTCGATCGCACCTTCCTCGAGAAGAAGCAAGAACTCTATAAGAAGGTGTTCCCGCACTTCTATATACTGGGGTGGTATTCGACTGGGAGTGATGCAGAGGAATCAGACATGCATATTCACAAAGCTTTGATGGATATCAATGAAAGTCCAGTTTATGTTCTTCTCAATCCTTCTATCAATCATTCTCAGAAGGATCTACCTGTCAGTATTTTTGAAAGTGAACTGCATGTCATAGATGGGATTCCACAACTTATCTTTGTTCGCTCAAGCTATACTATTGAGACTGTTGAAGCAGAACGAATATCAGTTGATCATGTTGCTCATCTTAAGCCATCTGATGGTGGTTCAGCTGCTACACAATTGGCTGCTCACCTTACTGGAATACACAGTGCCATCAAAATGCTTCATAGCAGAATAAAGGTGCTACATCACTATCTTCTTGCAATGCAAAAAGGTGATGTTCCTTGCGAGAATTCACTATTAAGACAAGTGTCAAGTCTCCTGAGAAGATTGCCTGCTATTGAATCTGGCAAATTTCAAGATGATTTCTTGATGGAGTACAATGACACCTTATTGATTAGTTACCTGGCAATGCTGACCAACTGCTCAAGTGCTATGAATGAACTGGTGGACAAATTTAATATTGCGTATGATAGGCATAGCAGAAGGGGTGGACGAACTGCTTTTATGTGA

>Glyma04g12890.1   sequence type=predicted peptide   gene model=Glyma04g12890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASSSSSGLTFKLHPLVIVNISDHYTRVKSQMNPTHAPPHNNNNANGGDGVVSPLSPRVYGCVIGVQKGRTVEIFNSFELLYDPSSHSLDRTFLEKKQELYKKVFPHFYILGWYSTGSDAEESDMHIHKALMDINESPVYVLLNPSINHSQKDLPVSIFESELHVIDGIPQLIFVRSSYTIETVEAERISVDHVAHLKPSDGGSAATQLAAHLTGIHSAIKMLHSRIKVLHHYLLAMQKGDVPCENSLLRQVSSLLRRLPAIESGKFQDDFLMEYNDTLLISYLAMLTNCSSAMNELVDKFNIAYDRHSRRGGRTAFM*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo