SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g12875

Feature Type:gene_model
Chromosome:Gm04
Start:12272665
stop:12273998
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g12875
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G26740AT Annotation by Michelle Graham. TAIR10: Ribosomal L32p protein family | chr1:9245280-9246555 REVERSE LENGTH=134 SoyBaseE_val: 7.00E-16ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0015934GO-cc Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
PF01783PFAM Ribosomal L32p protein family JGI ISS
UniRef100_B6EV28UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein L32 n=1 Tax=Populus alba RepID=B6EV28_POPAL SoyBaseE_val: 1.00E-16ISS
UniRef100_UPI000233A3BEUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A3BE related cluster n=1 Tax=unknown RepID=UPI000233A3BE SoyBaseE_val: 4.00E-51ISS

Expression Patterns of Glyma04g12875
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g12875 not represented in the dataset
Glyma04g12875 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g12875 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g115800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g12875
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g12875
>Glyma04g12875.1   sequence type=CDS   gene model=Glyma04g12875   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGAGCGATTGTGAAAATCACCGGAGGGAGATTGGGCAGCATTTTAGGGTTCTTCAATAGGTTCATTCATTCGTTGCCCCAATCTCCTCCTTTATCTGTGACCATTGATTTTAGTTCTCCAACTTTCTCTTCTTCTTTTGTGGGCTCTATGGAGCTCATGGCTGTCCCAAAACGCAAGGTTTCTCCCCATAAAAGAGGAATAAGGAATGGACCAAAAGCTCTTAAACCTATTCCTGTCATAGTCCTATGCAAGAAATCTCTCCAAGTTTGGGCTCACATTCGTGATTTGGCTCCTTTCTGTAGGCGTTTCACTTCTTTACAGCGCATTACTGACTTTTTAATTAGGGGCAGATCCACATCAGGTGTTCAAGGAAAATTATGTTGTCTGGCTATTGCAATTACAGTTTACTGTATCTGTCTGTCTAGGAACAAGCAGCTGATTTTTGAAGATTATCAATTTTCTGTAATAGAGGTTATTAACAAGATTAAGTTTCTTATGTATAGACAAGCGCACCTGTTGCAATTGTTTTAA
Predicted protein sequences of Glyma04g12875
>Glyma04g12875.1   sequence type=predicted peptide   gene model=Glyma04g12875   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRAIVKITGGRLGSILGFFNRFIHSLPQSPPLSVTIDFSSPTFSSSFVGSMELMAVPKRKVSPHKRGIRNGPKALKPIPVIVLCKKSLQVWAHIRDLAPFCRRFTSLQRITDFLIRGRSTSGVQGKLCCLAIAITVYCICLSRNKQLIFEDYQFSVIEVINKIKFLMYRQAHLLQLF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo