Glyma04g12845 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g12845

Feature Type:	gene_model
Chromosome:	Gm04
Start:	12228876
stop:	12233227
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g12845

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G22350	AT	Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF1022) \| chr5:7397762-7400746 REVERSE LENGTH=427	SoyBase	E_val: 2.00E-38	ISS
GO:0000266	GO-bp	Annotation by Michelle Graham. GO Biological Process: mitochondrial fission	SoyBase	N/A	ISS
GO:0033365	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein localization to organelle	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005741	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial outer membrane	SoyBase	N/A	ISS
PF06258	PFAM	Protein of unknown function (DUF1022)	JGI		ISS
UniRef100_I1LTX4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LTX4_SOYBN	SoyBase	E_val: 3.00E-46	ISS
UniRef100_Q93YN4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial fission protein n=1 Tax=Arabidopsis thaliana RepID=Q93YN4_ARATH	SoyBase	E_val: 1.00E-35	ISS

Expression Patterns of Glyma04g12845

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g12845 not represented in the dataset	Glyma04g12845 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g12845 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g115600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g12845

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g12845

Limit To All Plant Sequences

>Glyma04g12845.1   sequence type=CDS   gene model=Glyma04g12845   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTGGTAACTTCACTGGACAAAAGATATACTTATTCACCTTTATTTGTCTTTTAAACAATTATCAAATACTAATAGTTAAAGAACTTGGAAATAATCCAAAAGTTTATATTTGGGATGGGCAAGAACCAAACCCACAAATGGGGCATCTAGCTTGGGCCGATGCATTTGTTGTCACAACAGATTCAGTTAACATGATAAGTGAAGCTTGCAGCACTGGGAAGCCTGTGTATGTTATGGAAGCTGAGCGTTGCAGATGGAAGTTGACAGAATTCCACAAATCATTGAGAGAACGAGTTGTATTAAAATAA

Predicted protein sequences of Glyma04g12845

Limit To All Plant Sequences

>Glyma04g12845.1   sequence type=predicted peptide   gene model=Glyma04g12845   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFGNFTGQKIYLFTFICLLNNYQILIVKELGNNPKVYIWDGQEPNPQMGHLAWADAFVVTTDSVNMISEACSTGKPVYVMEAERCRWKLTEFHKSLRERVVLK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain