Glyma04g12780 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g12780): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g12780): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g12780

Feature Type:	gene_model
Chromosome:	Gm04
Start:	12107221
stop:	12108705
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g12780

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G12840	AT	Annotation by Michelle Graham. TAIR10: vacuolar ATP synthase subunit C (VATC) / V-ATPase C subunit / vacuolar proton pump C subunit (DET3) \| chr1:4375584-4378220 FORWARD LENGTH=375	SoyBase	E_val: 3.00E-26	ISS
GO:0000902	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell morphogenesis	SoyBase	N/A	ISS
GO:0006007	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucose catabolic process	SoyBase	N/A	ISS
GO:0006511	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0006816	GO-bp	Annotation by Michelle Graham. GO Biological Process: calcium ion transport	SoyBase	N/A	ISS
GO:0007030	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi organization	SoyBase	N/A	ISS
GO:0007033	GO-bp	Annotation by Michelle Graham. GO Biological Process: vacuole organization	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009809	GO-bp	Annotation by Michelle Graham. GO Biological Process: lignin biosynthetic process	SoyBase	N/A	ISS
GO:0009826	GO-bp	Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth	SoyBase	N/A	ISS
GO:0009853	GO-bp	Annotation by Michelle Graham. GO Biological Process: photorespiration	SoyBase	N/A	ISS
GO:0009932	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell tip growth	SoyBase	N/A	ISS
GO:0015991	GO-bp	Annotation by Michelle Graham. GO Biological Process: ATP hydrolysis coupled proton transport	SoyBase	N/A	ISS
GO:0016049	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell growth	SoyBase	N/A	ISS
GO:0016051	GO-bp	Annotation by Michelle Graham. GO Biological Process: carbohydrate biosynthetic process	SoyBase	N/A	ISS
GO:0030243	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellulose metabolic process	SoyBase	N/A	ISS
GO:0043255	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of carbohydrate biosynthetic process	SoyBase	N/A	ISS
GO:0048193	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport	SoyBase	N/A	ISS
GO:0048765	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair cell differentiation	SoyBase	N/A	ISS
GO:0051788	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to misfolded protein	SoyBase	N/A	ISS
GO:0080129	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly	SoyBase	N/A	ISS
GO:0000221	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar proton-transporting V-type ATPase, V1 domain	SoyBase	N/A	ISS
GO:0000325	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plant-type vacuole	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0046961	GO-mf	Annotation by Michelle Graham. GO Molecular Function: proton-transporting ATPase activity, rotational mechanism	SoyBase	N/A	ISS
UniRef100_B9RH03	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Vacuolar ATP synthase subunit C, putative n=1 Tax=Ricinus communis RepID=B9RH03_RICCO	SoyBase	E_val: 3.00E-26	ISS
UniRef100_I1MNN4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MNN4_SOYBN	SoyBase	E_val: 8.00E-32	ISS

Expression Patterns of Glyma04g12780

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g12780 not represented in the dataset	Glyma04g12780 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g12780 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g115400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g12780

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g12780

Limit To All Plant Sequences

>Glyma04g12780.1   sequence type=CDS   gene model=Glyma04g12780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGACGAGGTATAGGGTAGTGTCTCTCCCTATTCAAAATTCCGCATCCACTCTCTGGAACAAATTGCAGGAACAAATCTCCGAACACTCCTTCGACACTCTTCTCTACAGAAACCCTAGACTCCCTCCTTTCCCTCAGCAACAATATCGTCAAGTGTCGCACATGATCAGGCGGCAGATTGAGGAGCTAGAGAGTGTCTGGCATGGTGATCAGTGGTTTGATGGTGGATGGAGTCCCCGATTTAGTGTGCTTTTATGGTGGATGCAAGAGATCATCGATGGAATTCACGGTCAGGTGGCAAAGAATGAGGATGATCTCAAGGTTCATGTTTCCGAGTATAACAATATCTGCACTGACTTAAATGACCTATTTGCTATTCATAGAAAGATTGGCTCTTTGGCTATGAAACATTGA

Predicted protein sequences of Glyma04g12780

Limit To All Plant Sequences

>Glyma04g12780.1   sequence type=predicted peptide   gene model=Glyma04g12780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVTRYRVVSLPIQNSASTLWNKLQEQISEHSFDTLLYRNPRLPPFPQQQYRQVSHMIRRQIEELESVWHGDQWFDGGWSPRFSVLLWWMQEIIDGIHGQVAKNEDDLKVHVSEYNNICTDLNDLFAIHRKIGSLAMKH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain