SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g12770

Feature Type:gene_model
Chromosome:Gm04
Start:12072671
stop:12077180
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g12770
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G16520AT Annotation by Michelle Graham. TAIR10: UDP-glucosyl transferase 88A1 | chr3:5618807-5620833 REVERSE LENGTH=451 SoyBaseE_val: 8.00E-13ISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0008194GO-mf Annotation by Michelle Graham. GO Molecular Function: UDP-glycosyltransferase activity SoyBaseN/AISS
GO:0016757GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups SoyBaseN/AISS
GO:0016758GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring hexosyl groups SoyBaseN/AISS
GO:0080043GO-mf Annotation by Michelle Graham. GO Molecular Function: quercetin 3-O-glucosyltransferase activity SoyBaseN/AISS
GO:0080044GO-mf Annotation by Michelle Graham. GO Molecular Function: quercetin 7-O-glucosyltransferase activity SoyBaseN/AISS
GO:0080045GO-mf Annotation by Michelle Graham. GO Molecular Function: quercetin 3'-O-glucosyltransferase activity SoyBaseN/AISS
GO:0080046GO-mf Annotation by Michelle Graham. GO Molecular Function: quercetin 4'-O-glucosyltransferase activity SoyBaseN/AISS
UniRef100_E9M5F8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glycosyltransferase GT19J14 n=1 Tax=Pueraria montana var. lobata RepID=E9M5F8_PUEML SoyBaseE_val: 9.00E-85ISS
UniRef100_UPI000233A3BBUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A3BB related cluster n=1 Tax=unknown RepID=UPI000233A3BB SoyBaseE_val: 2.00E-115ISS

Expression Patterns of Glyma04g12770
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g12770
ParalogEvidenceComments
Glyma06g47900 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g12770 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g115300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g12770
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g12770
>Glyma04g12770.2   sequence type=CDS   gene model=Glyma04g12770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTGAGCTGGCCAAGCTTCTCGAAACACATAGTTATTCAATCACAATCCTCTTTACCACTGGCTTCCACGACCACCCTTCAGTCGACGCCTACAACCACCGCATCTCCACCTCCAATCCTTCCATCTCCTTCAACCACCTCCCTCATATCACCCCAACCATCACCTCAACCACCGTGAGCTTCGCTGCGAACGGCTTCGACTTTATCAAACGAAACACTTCCAACGTAGCCACCACCCTCACCCAAATCTCTAAATCCACCACCACCATAAAAGCCTTCGTGATCGACCTCTTCTGCACCACGGCGATGGAAGCAGCTTCTTCGTTGGGAATCCCAGTCTTTTACTTCTTCACTTCCGGTGCGGCGGTTCTCGAACTACACTCGTACTTTCCGAAACTTCACGAGGAAACCAACATGTCGTTTAAGGATATGGTCGCGGTGGAACTGCGCGTGACGGGAAACGCGCCGCTGAAGGCGGTGAACATGCTGCAACCCATATTTTGGAGAGGGAGGACCCTGCGTACTGGGACATGTTACAGTTCCGCACGCGCCTTCCAAAGGCGCGTGGGATCATAG
Predicted protein sequences of Glyma04g12770
>Glyma04g12770.2   sequence type=predicted peptide   gene model=Glyma04g12770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVELAKLLETHSYSITILFTTGFHDHPSVDAYNHRISTSNPSISFNHLPHITPTITSTTVSFAANGFDFIKRNTSNVATTLTQISKSTTTIKAFVIDLFCTTAMEAASSLGIPVFYFFTSGAAVLELHSYFPKLHEETNMSFKDMVAVELRVTGNAPLKAVNMLQPIFWRGRTLRTGTCYSSARAFQRRVGS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo