Report for Sequence Feature Glyma04g12690
Feature Type: gene_model
Chromosome: Gm04
Start: 11967502
stop: 11969111
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Expression Patterns of Glyma04g12690
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma04g12690 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma04g12690
Coding sequences of Glyma04g12690
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g12690.1 sequence type=CDS gene model=Glyma04g12690 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTATTGTTGTTCTTTGCACGAAACGACAATGAAGGGGATGTCTCAAAGTTTTGATATGATTGGAGCTATTGATGATAACAAAGAAACATTCAAGCTTATAGTTCGAATTGTGGACCGGGTTTGTCCAAGCCCGTGA
Predicted protein sequences of Glyma04g12690
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g12690.1 sequence type=predicted peptide gene model=Glyma04g12690 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MYCCSLHETTMKGMSQSFDMIGAIDDNKETFKLIVRIVDRVCPSP*