SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma04g12620

Feature Type:gene_model
Chromosome:Gm04
Start:11875415
stop:11876647
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G20860AT Annotation by Michelle Graham. TAIR10: FAD-binding Berberine family protein | chr4:11172726-11174318 FORWARD LENGTH=530 SoyBaseE_val: 3.00E-112ISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006865GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid transport SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0015706GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate transport SoyBaseN/AISS
GO:0015824GO-bp Annotation by Michelle Graham. GO Biological Process: proline transport SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0008762GO-mf Annotation by Michelle Graham. GO Molecular Function: UDP-N-acetylmuramate dehydrogenase activity SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016614GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on CH-OH group of donors SoyBaseN/AISS
GO:0050660GO-mf Annotation by Michelle Graham. GO Molecular Function: flavin adenine dinucleotide binding SoyBaseN/AISS
PTHR11748Panther D-LACTATE DEHYDROGENASE JGI ISS
PTHR11748:SF29Panther SUBFAMILY NOT NAMED JGI ISS
PF08031PFAM Berberine and berberine like JGI ISS
UniRef100_Q2PMD5UniRef Annotation by Michelle Graham. Most informative UniRef hit: FAD-linked oxidoreductase 1 n=1 Tax=Glycine max RepID=Q2PMD5_SOYBN SoyBaseE_val: 0ISS
UniRef100_UPI000233A3B6UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A3B6 related cluster n=1 Tax=unknown RepID=UPI000233A3B6 SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g113600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g12620.2   sequence type=CDS   gene model=Glyma04g12620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATCAGAAATTCAAGCAGCTATTCAATGCAGCAAAGAACTTGGGCTGCAGATCAGAGTCAGAAGTGGCGGCCATGATTATGAAGGGCTATCATATCTTTGAACCTGTGAATGGAAAGATTCATGATCGAAAATCAATGGGGGAAGATGTTTTCTGGGCCATAAGAGGAGGTAGTGCTACTAGTTTTGGAGTCATTCATGCATGGAAGATCAAGTTGGTTAGAGTTCCACCTATTGTTACAGGGTTCAACATTCACAAAACACTAGAAGAAGGAGCCACCAAGCTCATTCACAGGTGGCAACACATAGCACATGAATTGCATGAGGATCTTTTCATTAGAATAGTTGCTCAAAATAGTGGTGACAAATCAAAAACATTCCAAGCAACCTTCGAATTTCTCTTCCTTGGAAGACACGACAAGTTAATCCAACTGATGAATGAGAGTTTCCCAGAATTGGGATTGCAGGCCAAAGACTGCACTGAAATGAGCTGGATTCAATCAGTTTTATTCTTTGCTGGATACAACAAAGAGGACCCTCCAGAACTCTTGCTTAACAGAACTACCACGTATAAAAGCTCTTTCAAGGCCAAGTCTGACTTTGTAAAGGAGCCAATACCAAAAACTGGCTTAGAAGGAATTTGGAAAATGCTTCTAGAAGAAGAAACGTTAGCCTTGCTGTTAATGGAACCATATGGTGGTAGAATGAATGAAATTTCAGAATCTGAAATCCCTTTTCCCCACAGAAAGGGAAACTTGTACAACATACAATACTTGGTCAAATACATGACTCCTTATGTCTCAAAGTCTCCAAGAGCTGCCTATTTCAACTATAAGGATCTTGATTTAGGCAAAAACAAGTATCACAACACAAGCTACTCAAAAGCTAGTGTTTGGGGCAAGAAGTACTTTAAGGGAAACTTTAGAAGATTGACACAAATTAAGACAAAGTTTGACCCTCAAAATTTTTTCAGCAATGAACAGAGTATTTCTCTCCTGCATACCCATCCTTCTTAG

>Glyma04g12620.2   sequence type=predicted peptide   gene model=Glyma04g12620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNQKFKQLFNAAKNLGCRSESEVAAMIMKGYHIFEPVNGKIHDRKSMGEDVFWAIRGGSATSFGVIHAWKIKLVRVPPIVTGFNIHKTLEEGATKLIHRWQHIAHELHEDLFIRIVAQNSGDKSKTFQATFEFLFLGRHDKLIQLMNESFPELGLQAKDCTEMSWIQSVLFFAGYNKEDPPELLLNRTTTYKSSFKAKSDFVKEPIPKTGLEGIWKMLLEEETLALLLMEPYGGRMNEISESEIPFPHRKGNLYNIQYLVKYMTPYVSKSPRAAYFNYKDLDLGKNKYHNTSYSKASVWGKKYFKGNFRRLTQIKTKFDPQNFFSNEQSISLLHTHPS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo