Report for Sequence Feature Glyma04g12620
Feature Type: gene_model
Chromosome: Gm04
Start: 11875415
stop: 11876647
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g12620
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G20860 AT
Annotation by Michelle Graham. TAIR10: FAD-binding Berberine family protein | chr4:11172726-11174318 FORWARD LENGTH=530
SoyBase E_val: 3.00E-112 ISS
GO:0002679 GO-bp
Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response
SoyBase N/A ISS
GO:0006865 GO-bp
Annotation by Michelle Graham. GO Biological Process: amino acid transport
SoyBase N/A ISS
GO:0009407 GO-bp
Annotation by Michelle Graham. GO Biological Process: toxin catabolic process
SoyBase N/A ISS
GO:0010167 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to nitrate
SoyBase N/A ISS
GO:0010200 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to chitin
SoyBase N/A ISS
GO:0010583 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone
SoyBase N/A ISS
GO:0015706 GO-bp
Annotation by Michelle Graham. GO Biological Process: nitrate transport
SoyBase N/A ISS
GO:0015824 GO-bp
Annotation by Michelle Graham. GO Biological Process: proline transport
SoyBase N/A ISS
GO:0055114 GO-bp
Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0005829 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosol
SoyBase N/A ISS
GO:0003824 GO-mf
Annotation by Michelle Graham. GO Molecular Function: catalytic activity
SoyBase N/A ISS
GO:0008762 GO-mf
Annotation by Michelle Graham. GO Molecular Function: UDP-N-acetylmuramate dehydrogenase activity
SoyBase N/A ISS
GO:0009055 GO-mf
Annotation by Michelle Graham. GO Molecular Function: electron carrier activity
SoyBase N/A ISS
GO:0016491 GO-mf
Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity
SoyBase N/A ISS
GO:0016614 GO-mf
Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on CH-OH group of donors
SoyBase N/A ISS
GO:0050660 GO-mf
Annotation by Michelle Graham. GO Molecular Function: flavin adenine dinucleotide binding
SoyBase N/A ISS
PTHR11748 Panther
D-LACTATE DEHYDROGENASE
JGI ISS
PTHR11748:SF29 Panther
SUBFAMILY NOT NAMED
JGI ISS
PF08031 PFAM
Berberine and berberine like
JGI ISS
UniRef100_Q2PMD5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: FAD-linked oxidoreductase 1 n=1 Tax=Glycine max RepID=Q2PMD5_SOYBN
SoyBase E_val: 0 ISS
UniRef100_UPI000233A3B6 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233A3B6 related cluster n=1 Tax=unknown RepID=UPI000233A3B6
SoyBase E_val: 0 ISS
Expression Patterns of Glyma04g12620
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma04g12620 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g113600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g12620
Coding sequences of Glyma04g12620
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g12620.2 sequence type=CDS gene model=Glyma04g12620 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAATCAGAAATTCAAGCAGCTATTCAATGCAGCAAAGAACTTGGGCTGCAGATCAGAGTCAGAAGTGGCGGCCATGATTATGAAGGGCTATCATATCTTTGAACCTGTGAATGGAAAGATTCATGATCGAAAATCAATGGGGGAAGATGTTTTCTGGGCCATAAGAGGAGGTAGTGCTACTAGTTTTGGAGTCATTCATGCATGGAAGATCAAGTTGGTTAGAGTTCCACCTATTGTTACAGGGTTCAACATTCACAAAACACTAGAAGAAGGAGCCACCAAGCTCATTCACAGGTGGCAACACATAGCACATGAATTGCATGAGGATCTTTTCATTAGAATAGTTGCTCAAAATAGTGGTGACAAATCAAAAACATTCCAAGCAACCTTCGAATTTCTCTTCCTTGGAAGACACGACAAGTTAATCCAACTGATGAATGAGAGTTTCCCAGAATTGGGATTGCAGGCCAAAGACTGCACTGAAATGAGCTGGATTCAATCAGTTTTATTCTTTGCTGGATACAACAAAGAGGACCCTCCAGAACTCTTGCTTAACAGAACTACCACGTATAAAAGCTCTTTCAAGGCCAAGTCTGACTTTGTAAAGGAGCCAATACCAAAAACTGGCTTAGAAGGAATTTGGAAAATGCTTCTAGAAGAAGAAACGTTAGCCTTGCTGTTAATGGAACCATATGGTGGTAGAATGAATGAAATTTCAGAATCTGAAATCCCTTTTCCCCACAGAAAGGGAAACTTGTACAACATACAATACTTGGTCAAATACATGACTCCTTATGTCTCAAAGTCTCCAAGAGCTGCCTATTTCAACTATAAGGATCTTGATTTAGGCAAAAACAAGTATCACAACACAAGCTACTCAAAAGCTAGTGTTTGGGGCAAGAAGTACTTTAAGGGAAACTTTAGAAGATTGACACAAATTAAGACAAAGTTTGACCCTCAAAATTTTTTCAGCAATGAACAGAGTATTTCTCTCCTGCATACCCATCCTTCTTAG
Predicted protein sequences of Glyma04g12620
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g12620.2 sequence type=predicted peptide gene model=Glyma04g12620 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MNQKFKQLFNAAKNLGCRSESEVAAMIMKGYHIFEPVNGKIHDRKSMGEDVFWAIRGGSATSFGVIHAWKIKLVRVPPIVTGFNIHKTLEEGATKLIHRWQHIAHELHEDLFIRIVAQNSGDKSKTFQATFEFLFLGRHDKLIQLMNESFPELGLQAKDCTEMSWIQSVLFFAGYNKEDPPELLLNRTTTYKSSFKAKSDFVKEPIPKTGLEGIWKMLLEEETLALLLMEPYGGRMNEISESEIPFPHRKGNLYNIQYLVKYMTPYVSKSPRAAYFNYKDLDLGKNKYHNTSYSKASVWGKKYFKGNFRRLTQIKTKFDPQNFFSNEQSISLLHTHPS*